KEGG   Escherichia coli K-12 MG1655: b2987Help
Entry
b2987             CDS       T00007                                 

Gene name
pitB
Definition
(RefSeq) phosphate transporter
  KO
K16322  low-affinity inorganic phosphate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2987 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-GeneID: 947475
NCBI-ProteinID: NP_417461
Pasteur: pitB
RegulonDB: ECK120002422
ECOCYC: EG12883
ASAP: ABE-0009800
UniProt: P43676
Position
complement(3134872..3136371)
Genome map
AA seq 499 aa AA seqDB search
MLNLFVGLDIYTGLLLLLALAFVLFYEAINGFHDTANAVAAVIYTRAMQPQLAVVMAAFF
NFFGVLLGGLSVAYAIVHMLPTDLLLNMGSTHGLAMVFSMLLAAIIWNLGTWFFGLPASS
SHTLIGAIIGIGLTNALLTGSSVMDALNLREVTKIFSSLIVSPIVGLVIAGGLIFLLRRY
WSGTKKRDRIHRIPEDRKKKKGKRKPPFWTRIALIVSAAGVAFSHGANDGQKGIGLVMLV
LVGIAPAGFVVNMNASGYEITRTRDAVTNFEHYLQQHPELPQKLIAMEPPLPAASTDGTQ
VTEFHCHPANTFDAIARVKTMLPGNMESYEPLSVSQRSQLRRIMLCISDTSAKLAKLPGV
SKEDQNLLKKLRSDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVAMTIGEKIGKRGMTY
AQGMAAQMTAAVSIGLASYIGMPVSTTHVLSSAVAGTMVVDGGGLQRKTVTSILMAWVFT
LPAAIFLSGGLYWIALQLI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatttatttgttggccttgatatatacacagggcttttgttattgcttgctctg
gcatttgtgttgttctacgaagcaatcaatggttttcatgacacggcgaatgcggtggca
gccgttatttatactcgtgccatgcaaccacaacttgctgtggtgatggcggcatttttt
aacttttttggcgtgttattgggcggacttagcgttgcctatgccattgtccatatgttg
ccaaccgatttgttgctgaatatggggtcaacccacggcctggcgatggtcttttccatg
ctgctggcggcgattatctggaacctgggaacgtggttcttcggtttaccggcctccagt
tcgcacaccttgattggtgcgattatcggcatcggtttaaccaacgcgctgttaaccggc
tcatcggtgatggatgcgttaaacctgcgtgaagtgaccaaaattttctcctcgctgatt
gtttcccctatcgtcggcctggtcattgcgggaggcctgatattcctgctgcgacgctac
tggagcgggacgaaaaagcgtgaccgtattcaccgcattccggaagatcgcaaaaagaaa
aaaggcaaacgtaaaccgccattctggacgcgtattgcgctgattgtttccgctgcgggc
gtggcgttttcgcacggcgcgaacgacggacaaaaagggatcggcctggtaatgctggta
ctggtggggattgcccctgctggcttcgtcgtcaatatgaatgcgtccggctatgaaatt
acccgtacccgcgatgccgttaccaacttcgaacactacctgcaacagcatcctgaactg
ccgcagaagttgattgcgatggaacctccattgcctgcagcatcgactgatggcacgcaa
gtaacagagtttcactgtcatccggcaaatacctttgatgctattgcgcgcgttaaaacg
atgctgccaggcaatatggaaagttacgagccgttaagcgtgagtcagcgcagccagctg
cgccgcattatgctgtgcatctctgatacctccgcgaagctagcgaaactgccaggcgtc
agtaaagaagaccagaacctgctgaaaaaacttcgcagcgatatgttaagcaccattgag
tacgctccggtgtggatcatcatggcggtagcactggcgctcggcattggcaccatgatt
ggctggcgtcgtgtagcgatgaccatcggtgagaagattggtaagcgcggcatgacgtat
gcgcaaggcatggcggcacaaatgacggcggcagtgtctatcggtcttgccagttatatt
gggatgcccgtctccacaacacacgtcctctcgtctgcagttgcagggacgatggtggtg
gacggcggtgggttacagcgtaaaacggtaaccagcatcctgatggcgtgggtatttact
ttaccggcggcaatttttctttctggtgggctgtactggatagcattgcagttgatttaa

DBGET integrated database retrieval system