KEGG   Escherichia coli K-12 MG1655: b2997Help
Entry
b2997             CDS       T00007                                 

Gene name
hybO
Definition
(RefSeq) hydrogenase 2, small subunit (EC:1.12.99.6)
  KO
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    b2997 (hybO)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     b2997 (hybO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3145143..3146261)
Genome map
AA seq 372 aa AA seqDB search
MTGDNTLIHSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVTNPQRPPVIWIGAQECT
GCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGS
IPLKDNGIYCMVAGEPIVDHIRKAAEGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVL
PGKTVINIPGCPPNPHNFLATVAHIITYGKPPKLDDKNRPTFAYGRLIHEHCERRPHFDA
GRFAKEFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGI
GFHKGIHQLANVENQTPRSQKPDVNAKEGGNVSAGAIGLLGGVVGLVAGVSVMAVRELGR
QQKKDNADSRGE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgactggagataacaccctcatccattctcacggcattaaccgtcgtgatttcatgaag
ctttgtgcagcattagccgccaccatggggttaagtagcaaagccgctgcagagatggcc
gaatcggttactaacccgcagcgtccgccagttatctggattggcgcgcaggagtgcacc
ggttgtacggaatctctgcttcgtgcaacgcatccaacggtagaaaacctcgtactggag
actatctctctggagtatcacgaagtgctttccgccgccttcggtcatcaggtcgaagag
aacaaacataacgctctcgagaagtacaaagggcagtatgtgttagtggtggatggttcc
atcccattaaaagataacggtatttattgcatggttgccggtgagccgattgtggatcac
atccgcaaagcggcggaaggcgcagcagccattatcgctatcggttcctgctctgcgtgg
ggcggtgttgccgcagctggagttaacccaactggcgcagtcagcctgcaagaagttctg
ccaggcaaaaccgttatcaatattccgggctgcccgccgaacccgcacaacttcctcgcg
accgttgcgcacatcatcacttacggcaaaccgccgaaactggatgacaaaaaccgtccg
accttcgcctatggccgtctgattcacgaacactgcgaacgtcgcccgcacttcgatgct
ggtcgttttgccaaagagttcggtgatgaaggccaccgcgaaggctggtgcctgtaccac
ctcggctgtaaagggccagaaacttacggcaactgctcaacgctgcaattctgcgatgtt
ggcggtgtgtggccggtggcgattggtcacccttgctatggctgtaacgaagaaggtatc
ggcttccataaaggcatccatcagcttgccaacgtcgaaaatcaaactccgcgttcacag
aaaccggatgttaacgctaaagagggcggcaacgtctctgcaggcgctattggtttgctc
ggcggtgtggttgggttggttgccggtgtcagcgtgatggcggtgcgtgaactgggtcgt
cagcaaaagaaagataacgctgactcacggggagaataa

DBGET integrated database retrieval system