KEGG   Escherichia coli K-12 MG1655: b3002Help
Entry
b3002             CDS       T00007                                 

Gene name
yqhA
Definition
(RefSeq) UPF0114 family putative inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0114
Motif
Other DBs
NCBI-GeneID: 947479
NCBI-ProteinID: NP_417475
Pasteur: yqhA
RegulonDB: ECK120004119
ECOCYC: G7559
ASAP: ABE-0009850
UniProt: P67244
Position
complement(3148977..3149471)
Genome map
AA seq 164 aa AA seqDB search
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL
VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH
LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttttcttgaaaatgcaatgtatgcttctcgctggctgcttgcccccgtgtac
tttggcctttcgctggcgttagttgccctggcgctgaagttcttccaggagattattcac
gtactgccgaatatcttctcgatggcggaatcagatttgatcctcgtgttgctgtcgctg
gtggatatgacgctggttggcggtttgctggtgatggtgatgttttccggttatgagaat
ttcgtctcacagctggatatctccgagaacaaagagaagctgaactggctggggaaaatg
gacgcaacgtcgctgaaaaacaaagtagcagcgtcgattgtggcaatttcttccattcac
ttactgcgcgtctttatggatgcgaaaaatgtcccggataacaaactgatgtggtacgtc
attatccatctgacgtttgtgctttctgcatttgtgatgggctatcttgaccgactgact
cgtcataatcactga

DBGET integrated database retrieval system