KEGG   Escherichia coli K-12 MG1655: b3005Help
Entry
b3005             CDS       T00007                                 

Gene name
exbD
Definition
(RefSeq) membrane spanning protein in TonB-ExbB-ExbD complex
  KO
K03559  biopolymer transport protein ExbD
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b3005 (exbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ExbD
Motif
Other DBs
NCBI-GeneID: 946345
NCBI-ProteinID: NP_417478
Pasteur: exbD
RegulonDB: ECK120000266
ECOCYC: EG10272
ASAP: ABE-0009866
UniProt: P0ABV2
Structure
PDB: 

Jmol
Position
complement(3150818..3151243)
Genome map
AA seq 141 aa AA seqDB search
MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRP
EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMD
TLHQAGYLKIGLVGEETAKAK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcatcttaacgaaaacctcgacgataacggcgaaatgcatgatatcaacgtg
acgccgtttatcgacgtgatgttggttctgctgattatctttatggtggcggcaccgtta
gcgacggtagatgtgaaggtgaacttgcctgcttctaccagcacgccgcagccgcgcccg
gaaaaaccggtttatctgtcggtgaaggcagacaactcgatgtttatcggtaacgatccg
gtcaccgatgaaacaatgattacggcgttgaatgcgttaaccgaaggcaagaaagacacc
accatcttcttccgagcggacaaaaccgtcgattacgagacgttgatgaaggtaatggat
acgctgcatcaggcgggttacctgaagataggtctggtcggcgaagaaaccgccaaagcg
aagtaa

DBGET integrated database retrieval system