KEGG   Escherichia coli K-12 MG1655: b3005Help
Entry
b3005             CDS       T00007                                 

Gene name
exbD
Definition
(RefSeq) membrane spanning protein in TonB-ExbB-ExbD complex
  KO
K03559  
biopolymer transport protein ExbD
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b3005 (exbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3150818..3151243)
Genome map
AA seq 141 aa AA seqDB search
MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRP
EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMD
TLHQAGYLKIGLVGEETAKAK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcatcttaacgaaaacctcgacgataacggcgaaatgcatgatatcaacgtg
acgccgtttatcgacgtgatgttggttctgctgattatctttatggtggcggcaccgtta
gcgacggtagatgtgaaggtgaacttgcctgcttctaccagcacgccgcagccgcgcccg
gaaaaaccggtttatctgtcggtgaaggcagacaactcgatgtttatcggtaacgatccg
gtcaccgatgaaacaatgattacggcgttgaatgcgttaaccgaaggcaagaaagacacc
accatcttcttccgagcggacaaaaccgtcgattacgagacgttgatgaaggtaatggat
acgctgcatcaggcgggttacctgaagataggtctggtcggcgaagaaaccgccaaagcg
aagtaa

DBGET integrated database retrieval system