KEGG   Escherichia coli K-12 MG1655: b3006Help
Entry
b3006             CDS       T00007                                 

Gene name
exbB
Definition
(RefSeq) membrane spanning protein in TonB-ExbB-ExbD complex
  KO
K03561  
biopolymer transport protein ExbB
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b3006 (exbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3151250..3151984)
Genome map
AA seq 244 aa AA seqDB search
MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQ
LLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVA
AVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA
TAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQK
LRAG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaataatttaatgcagacggacctttccgtctggggtatgtatcagcacgccgat
attgtcgttaagtgcgtgatgattgggcttattttggcctccgtagtcacctgggcaatc
ttcttcagtaagagcgtagagttcttcaatcagaagcgtcgccttaagcgcgagcagcaa
ctgctggctgaagcgcgttccttaaaccaggccaacgatatcgccgctgattttggtagc
aaaagcttaagcctgcatttgctcaatgaagcgcagaatgagctggaactgtcagaaggc
agcgacgataacgaaggtattaaagaacgtaccagcttccgtctggagcgtcgggtcgcc
gcagtgggtcgtcaaatgggccgcggtaacggctatctggcaaccatcggcgcgatttct
ccgttcgttggtctgtttggtacggtctggggcatcatgaacagctttattggtatcgcg
caaacgcagaccactaacctggcagtcgttgcgccgggtatcgcagaagctctgttagca
acggcaatcggcctcgtggcagcgattcctgcggtcgttatctataacgtatttgcacgc
cagattggcggctttaaagcgatgctgggtgatgttgcagcgcaggtattgttgctgcaa
agccgtgacctggatctggaagccagcgccgctgcgcatccggttcgtgtcgcacaaaaa
ttacgcgcaggataa

DBGET integrated database retrieval system