KEGG   Escherichia coli K-12 MG1655: b3020Help
Entry
b3020             CDS       T00007                                 

Gene name
ygiS
Definition
(RefSeq) putative inner membrane ABC superfamily transporter permease
  KO
K02035  
peptide/nickel transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Peptides/nickel transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    b3020 (ygiS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3166111..3167718)
Genome map
AA seq 535 aa AA seqDB search
MYTRNLLWLVSLVSAAPLYAADVPANTPLAPQQVFRYNNHSDPGTLDPQKVEENTAAQIV
LDLFEGLVWMDGEGQVQPAQAERWEILDGGKRYIFHLRSGLQWSDGQPLTAEDFVLGWQR
AVDPKTASPFAGYLAQAHINNAAAIVAGKADVTSLGVKATDDRTLEVTLEQPVPWFTTML
AWPTLFPVPHHVIAKHGDSWSKPENMVYNGAFVLDQWVVNEKITARKNPKYRDAQHTVLQ
QVEYLALDNSVTGYNRYRAGEVDLTWVPAQQIPAIEKSLPGELRIIPRLNSEYYNFNLEK
PPFNDVRVRRALYLTVDRQLIAQKVLGLRTPATTLTPPEVKGFSATTFDELQKPMSERVA
MAKALLKQAGYDASHPLRFELFYNKYDLHEKTAIALSSEWKKWLGAQVTLRTMEWKTYLD
ARRAGDFMLSRQSWDATYNDASSFLNTLKSDSEENVGHWKNAQYDALLNQATQITDATKR
NALYQQAEVIINQQAPLIPIYYQPLIKLLKPYVGGFPLHNPQDYVYSKELYIKAH
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtatacgcgaaatttattatggctggtcagcctggtaagtgcggctcctctctacgct
gctgacgttcccgccaacacaccgctcgccccgcaacaagtctttcgttacaacaatcat
agcgacccaggtacgctcgacccgcaaaaggtggaggagaatactgccgcgcagattgtg
ctggatctgtttgaaggtctggtatggatggacggtgaaggccaggtgcagcccgctcag
gctgaacgctgggagatactggacggcggcaagcgctatattttccatctgcgtagcggt
ttgcagtggtccgacggtcagcctctgacggcagaggattttgtcctcggctggcagcgc
gcggttgacccgaaaacggcaagcccttttgctggctatctggcacaggcgcacattaac
aatgccgcagctattgttgcgggtaaagcagatgttacatcgctgggtgtcaaagcgacg
gatgatcgtactcttgaagttacgcttgagcagccggttccttggttcacgacgatgctc
gcctggccgacgctgttcccggttcctcatcatgtcatcgctaaacatggcgatagctgg
agtaagccagagaacatggtttacaacggtgcctttgtgcttgatcagtgggtagttaac
gaaaagattactgcacgcaaaaatccaaagtaccgcgatgcgcaacatacagtattgcaa
caggttgagtatctggcgctagataattcggtcaccggctataaccgctatcgcgcggga
gaggtcgatctcacctgggttccggcgcagcaaattcccgccattgaaaaatcactgcct
ggcgagctacgaattattccgcgtctgaacagcgaatattacaacttcaaccttgagaaa
ccgccatttaacgatgtgcgagtgcgtcgggcgctatatcttacggttgatcgacagctt
attgcgcaaaaggtactggggttgagaacgcccgcaaccacgctgacgccgccagaggta
aaaggctttagcgcgacgacgttcgatgaactgcaaaagccaatgagtgagcgcgtcgcg
atggcaaaagccttgctgaaacaggcgggatacgacgcctctcatccgctacgctttgag
ctgttctacaacaagtacgatctgcatgaaaagaccgcgatagcgttgtcttccgaatgg
aaaaaatggctgggtgcacaggtgacgctgcgcacaatggagtggaaaacctatcttgat
gcccgacgagccggtgatttcatgctgtctcggcagtcgtgggatgcgacgtacaatgat
gcttccagcttcctgaacacgctcaaaagcgatagtgaagaaaacgtcggtcactggaaa
aatgcgcagtatgacgccttactaaaccaggccacgcagatcactgatgcgacaaagcgt
aatgcgttgtatcagcaggcagaagtgatcatcaaccaacaggcaccgctgattcctatc
tactatcagccgttaatcaaactgcttaaaccctacgttggcggttttccgctgcataat
ccccaggattatgtctacagcaaagagttgtatatcaaggcacattga

DBGET integrated database retrieval system