KEGG   Escherichia coli K-12 MG1655: b3024Help
Entry
b3024             CDS       T00007                                 

Gene name
ygiW
Definition
(RefSeq) hydrogen peroxide and cadmium resistance periplasmic protein; stress-induced OB-fold protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BOF
Motif
Other DBs
NCBI-GeneID: 946051
NCBI-ProteinID: NP_417496
Pasteur: ygiW
RegulonDB: ECK120004132
ECOCYC: G7574
ASAP: ABE-0009930
UniProt: P0ADU5
Structure
PDB: 

Jmol
Position
complement(3169284..3169676)
Genome map
AA seq 130 aa AA seqDB search
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
DVKQIRKVNP
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcgcagcagtaatcgcagtaatggccctgtgcagcgcaccggtgatggca
gcagagcagggcggtttttctggcccatcggcaacgcaaagtcaggccggaggattccag
gggccgaacggcagcgtaacgactgtagaaagcgcaaaatccctgcgtgacgacacctgg
gtaaccctgcgcggcaatatcgttgaacgcatctctgacgatctctacgtgttcaaagat
gccagcggtactatcaatgttgatatcgaccacaaacgctggaacggcgtgacggtgacg
ccgaaagatacggttgagattcagggtgaagtcgataaagactggaattctgttgaaatt
gacgtcaaacagatccgcaaagtaaatccgtaa

DBGET integrated database retrieval system