KEGG   Escherichia coli K-12 MG1655: b3024Help
Entry
b3024             CDS       T00007                                 

Gene name
ygiW
Definition
(RefSeq) hydrogen peroxide and cadmium resistance periplasmic protein; stress-induced OB-fold protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3169284..3169676)
Genome map
AA seq 130 aa AA seqDB search
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
DVKQIRKVNP
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcgcagcagtaatcgcagtaatggccctgtgcagcgcaccggtgatggca
gcagagcagggcggtttttctggcccatcggcaacgcaaagtcaggccggaggattccag
gggccgaacggcagcgtaacgactgtagaaagcgcaaaatccctgcgtgacgacacctgg
gtaaccctgcgcggcaatatcgttgaacgcatctctgacgatctctacgtgttcaaagat
gccagcggtactatcaatgttgatatcgaccacaaacgctggaacggcgtgacggtgacg
ccgaaagatacggttgagattcagggtgaagtcgataaagactggaattctgttgaaatt
gacgtcaaacagatccgcaaagtaaatccgtaa

DBGET integrated database retrieval system