KEGG   Escherichia coli K-12 MG1655: b3035Help
Entry
b3035             CDS       T00007                                 

Gene name
tolC
Definition
(RefSeq) transport channel
  KO
K12340  
outer membrane protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
beta-Lactam resistance
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Bacterial secretion system
Module
Multidrug resistance, efflux pump AcrAD-TolC
Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Multidrug resistance, efflux pump AcrEF-TolC
Multidrug resistance, efflux pump MdtEF-TolC
Macrolide resistance, MacAB-TolC transporter
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b3035 (tolC)
  Signal transduction
   02020 Two-component system
    b3035 (tolC)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    b3035 (tolC)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b3035 (tolC)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b3035 (tolC)
Secretion system [BR:eco02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter [MD:M00325]
   b3035 (tolC)
  RTX toxin transporter [MD:M00326]
   b3035 (tolC)
  RaxAB-RaxC type I secretion system protein [MD:M00339]
   b3035 (tolC)
  AlgE-type Mannuronan C-5-Epimerase transporter [MD:M00571]
   b3035 (tolC)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    b3035 (tolC)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    b3035 (tolC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3178115..3179596
Genome map
AA seq 493 aa AA seqDB search
MKKLLPILIGLSLSGFSSLSQAENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPL
LPQLGLGADYTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTY
QTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNAR
AQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEK
RNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSN
MGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASI
SSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQL
NIKSALGTLNEQDLLALNNALSKPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSA
RTTTSNGHNPFRN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattgctccccattcttatcggcctgagcctttctgggttcagttcgttgagc
caggccgagaacctgatgcaagtttatcagcaagcacgccttagtaacccggaattgcgt
aagtctgccgccgatcgtgatgctgcctttgaaaaaattaatgaagcgcgcagtccatta
ctgccacagctaggtttaggtgcagattacacctatagcaacggctaccgcgacgcgaac
ggcatcaactctaacgcgaccagtgcgtccttgcagttaactcaatccatttttgatatg
tcgaaatggcgtgcgttaacgctgcaggaaaaagcagcagggattcaggacgtcacgtat
cagaccgatcagcaaaccttgatcctcaacaccgcgaccgcttatttcaacgtgttgaat
gctattgacgttctttcctatacacaggcacaaaaagaagcgatctaccgtcaattagat
caaaccacccaacgttttaacgtgggcctggtagcgatcaccgacgtgcagaacgcccgc
gcacagtacgataccgtgctggcgaacgaagtgaccgcacgtaataaccttgataacgcg
gtagagcagctgcgccagatcaccggtaactactatccggaactggctgcgctgaatgtc
gaaaactttaaaaccgacaaaccacagccggttaacgcgctgctgaaagaagccgaaaaa
cgcaacctgtcgctgttacaggcacgcttgagccaggacctggcgcgcgagcaaattcgc
caggcgcaggatggtcacttaccgactctggatttaacggcttctaccgggatttctgac
acctcttatagcggttcgaaaacccgtggtgccgctggtacccagtatgacgatagcaat
atgggccagaacaaagttggcctgagcttctcgctgccgatttatcagggcggaatggtt
aactcgcaggtgaaacaggcacagtacaactttgtcggtgccagcgagcaactggaaagt
gcccatcgtagcgtcgtgcagaccgtgcgttcctccttcaacaacattaatgcatctatc
agtagcattaacgcctacaaacaagccgtagtttccgctcaaagctcattagacgcgatg
gaagcgggctactcggtcggtacgcgtaccattgttgatgtgttggatgcgaccaccacg
ttgtacaacgccaagcaagagctggcgaatgcgcgttataactacctgattaatcagctg
aatattaagtcagctctgggtacgttgaacgagcaggatctgctggcactgaacaatgcg
ctgagcaaaccggtttccactaatccggaaaacgttgcaccgcaaacgccggaacagaat
gctattgctgatggttatgcgcctgatagcccggcaccagtcgttcagcaaacatccgca
cgcactaccaccagtaacggtcataaccctttccgtaactga

DBGET integrated database retrieval system