KEGG   Escherichia coli K-12 MG1655: b3040Help
Entry
b3040             CDS       T00007                                 

Gene name
zupT
Definition
(RefSeq) zinc transporter
  KO
K07238  
zinc transporter, ZIP family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3040 (zupT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3182550..3183323
Genome map
AA seq 257 aa AA seqDB search
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE
GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN
FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA
EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG
MSVMGFSLVLLQTAGIG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacctctcattctgaccatactggcgggggcagccacgtttattggcgcgttt
ctcggcgttctcgggcaaaaaccctcgaaccgcttactggcgttttcgctaggttttgcg
gcggggatcatgttgctcatctcattaatggaaatgcttcctgccgcactagcagctgaa
ggaatgtcgcctgtgttgggttatggaatgtttatcttcggtctgcttggctattttggc
ctggaccgcatgttgccacatgctcatccgcaggatttaatgcaaaaatcggtgcagccg
ttgccaaaatcgatcaagcgcacagccattctgctcactctcggcatcagtctgcataac
ttcccggaagggattgccacctttgtcacggcgagcagcaacctggagctgggatttggc
atcgcactggccgtcgcgttgcacaatatccctgaaggtctggcagtggcaggcccggtt
tatgcggcaacggggtctaaacgcaccgcgattctgtgggcggggatttctggactagca
gaaattcttggtggtgtgctggcgtggttaatcctcggtagcatgatttccccggtggtc
atggcggcaatcatggcggcggttgcaggaattatggtggcgctctcggttgatgaatta
atgccgctcgccaaagagattgaccctaataataaccccagctatggcgtactatgtgga
atgtcagtgatgggattcagtttagtgctgctacaaacggcgggaattggttaa

DBGET integrated database retrieval system