KEGG   Escherichia coli K-12 MG1655: b3059Help
Entry
b3059             CDS       T00007                                 

Gene name
plsY
Definition
(RefSeq) putative glycerol-3-phosphate acyltransferase
  KO
K08591  
glycerol-3-phosphate acyltransferase PlsY [EC:2.3.1.15]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    b3059 (plsY)
   00564 Glycerophospholipid metabolism
    b3059 (plsY)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     b3059 (plsY)
Lipid biosynthesis proteins [BR:eco01004]
 Phospholipid acyltransferase
  GPAT
   b3059 (plsY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ASAP: 
UniProt: 
Position
3204694..3205311
Genome map
AA seq 205 aa AA seqDB search
MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI
FDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW
DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN
IQRLWRRQETKIWTKFKRKREKDPE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaatcgcgcctggaatgatcctcatcgcgtacctctgcggctccatttccagt
gccattctggtttgccgcttgtgtgggctgcccgatccgcgaaccagcggctccggcaat
ccaggcgcaaccaatgtgttacgtatcggtggcaagggagcagccgtagcagtactgatt
ttcgacgttctgaaaggaatgttgcccgtctggggcgcgtatgaattaggtgtcagcccc
ttctggctaggcttaattgccatcgccgcctgtcttggacacatctggcccgttttcttc
ggatttaaaggaggaaaaggcgttgctaccgcttttggtgccatcgcacccattggctgg
gatctcaccggagtaatggcgggaacctggttactgaccgtgctattgagcggatactcg
tcgctgggagcgattgtcagtgcactgattgctccgttttatgtctggtggtttaagcca
caattcaccttcccggtttcgatgctctcttgcctgatcctgctgcgtcatcatgacaac
atccaacgtctgtggcgtcgtcaggagacaaaaatctggacgaaattcaaaagaaagcgc
gaaaaggatcccgagtga

DBGET integrated database retrieval system