KEGG   Escherichia coli K-12 MG1655: b3061Help
Entry
b3061             CDS       T00007                                 

Gene name
ttdA
Definition
(RefSeq) L-tartrate dehydratase, alpha subunit (EC:4.2.1.32)
  KO
K03779  
L(+)-tartrate dehydratase alpha subunit [EC:4.2.1.32]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glyoxylate and dicarboxylate metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b3061 (ttdA)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.32  L(+)-tartrate dehydratase
     b3061 (ttdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3206463..3207374
Genome map
AA seq 303 aa AA seqDB search
MMSESNKQQAVNKLTEIVANFTAMISTRMPDDVVDKLKQLKDAETSSMGKIIYHTMFDNM
QKAIDLNRPACQDTGEIMFFVKVGSRFPLLGELQSILKQAVEEATVKAPLRHNAVEIFDE
VNTGKNTGSGVPWVTWDIIPDNDDAEIEVYMAGGGCTLPGRSKVLMPSEGYEGVVKFVFE
NISTLAVNACPPVLVGVGIATSVETAAVLSRKAILRPIGSRHPNPKAAELELRLEEGLNR
LGIGPQGLTGNSSVMGVHIESAARHPSTIGVAVSTGCWAHRRGTLLVHADLTFENLSHTR
SAL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgaaagtaataagcaacaggcagtgaataagttgacagagattgtcgctaac
tttaccgccatgatttctacccgaatgcctgatgacgtggtggataaactaaaacagcta
aaggatgccgaaacgtcgtcgatggggaaaattatctaccatacgatgttcgacaacatg
caaaaagcgattgacctgaatcgtcctgcctgtcaggacaccggggagattatgttcttc
gttaaagtcggttcccgcttcccactgcttggcgagctgcaaagcatactcaaacaagcc
gtggaagaggcaaccgtcaaagcgccactacgtcacaatgcggtagaaatttttgacgaa
gtaaacaccggcaaaaataccggtagcggcgtaccgtgggtcacctgggacatcatcccc
gacaatgacgatgcggaaatcgaagtttacatggcaggcggcggctgcacgctacctggc
cgctcgaaagtgttaatgccgtcagaaggctacgaaggcgtggtgaaattcgtcttcgaa
aatatctccaccctcgccgtaaacgcctgtccaccggtactggtgggcgtgggcatcgcc
acctcggtggaaaccgccgccgtactctcgcgtaaagccattttgcgcccgattggcagc
cgccatcccaatccaaaagcggcagaactggagctacgcctggaagaaggactcaaccgt
ctggggattggtccacaagggctgaccggcaacagttcagtgatgggcgtacatatcgaa
tctgccgcccgccatccgtcaaccatcggcgttgctgtctctaccggctgctgggcgcat
cgtcgcggcacgctgctggttcatgccgatctcacctttgaaaatctgtctcacacccgg
agcgcgttatga

DBGET integrated database retrieval system