KEGG   Escherichia coli K-12 MG1655: b3061Help
Entry
b3061             CDS       T00007                                 

Gene name
ttdA
Definition
(RefSeq) L-tartrate dehydratase, alpha subunit
  KO
K03779  L(+)-tartrate dehydratase alpha subunit [EC:4.2.1.32]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00630  Glyoxylate and dicarboxylate metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b3061 (ttdA)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.32  L(+)-tartrate dehydratase
     b3061 (ttdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumerase Rho_Binding TTRAP
Motif
Other DBs
NCBI-GeneID: 947565
NCBI-ProteinID: NP_417533
Pasteur: ttdA
RegulonDB: ECK120001151
ECOCYC: EG11168
ASAP: ABE-0010050
UniProt: P05847
Position
3206463..3207374
Genome map
AA seq 303 aa AA seqDB search
MMSESNKQQAVNKLTEIVANFTAMISTRMPDDVVDKLKQLKDAETSSMGKIIYHTMFDNM
QKAIDLNRPACQDTGEIMFFVKVGSRFPLLGELQSILKQAVEEATVKAPLRHNAVEIFDE
VNTGKNTGSGVPWVTWDIIPDNDDAEIEVYMAGGGCTLPGRSKVLMPSEGYEGVVKFVFE
NISTLAVNACPPVLVGVGIATSVETAAVLSRKAILRPIGSRHPNPKAAELELRLEEGLNR
LGIGPQGLTGNSSVMGVHIESAARHPSTIGVAVSTGCWAHRRGTLLVHADLTFENLSHTR
SAL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgaaagtaataagcaacaggcagtgaataagttgacagagattgtcgctaac
tttaccgccatgatttctacccgaatgcctgatgacgtggtggataaactaaaacagcta
aaggatgccgaaacgtcgtcgatggggaaaattatctaccatacgatgttcgacaacatg
caaaaagcgattgacctgaatcgtcctgcctgtcaggacaccggggagattatgttcttc
gttaaagtcggttcccgcttcccactgcttggcgagctgcaaagcatactcaaacaagcc
gtggaagaggcaaccgtcaaagcgccactacgtcacaatgcggtagaaatttttgacgaa
gtaaacaccggcaaaaataccggtagcggcgtaccgtgggtcacctgggacatcatcccc
gacaatgacgatgcggaaatcgaagtttacatggcaggcggcggctgcacgctacctggc
cgctcgaaagtgttaatgccgtcagaaggctacgaaggcgtggtgaaattcgtcttcgaa
aatatctccaccctcgccgtaaacgcctgtccaccggtactggtgggcgtgggcatcgcc
acctcggtggaaaccgccgccgtactctcgcgtaaagccattttgcgcccgattggcagc
cgccatcccaatccaaaagcggcagaactggagctacgcctggaagaaggactcaaccgt
ctggggattggtccacaagggctgaccggcaacagttcagtgatgggcgtacatatcgaa
tctgccgcccgccatccgtcaaccatcggcgttgctgtctctaccggctgctgggcgcat
cgtcgcggcacgctgctggttcatgccgatctcacctttgaaaatctgtctcacacccgg
agcgcgttatga

DBGET integrated database retrieval system