KEGG   Escherichia coli K-12 MG1655: b3067Help
Entry
b3067             CDS       T00007                                 

Gene name
rpoD
Definition
(RefSeq) RNA polymerase, sigma 70 (sigma D) factor
  KO
K03086  
RNA polymerase primary sigma factor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription machinery [BR:eco03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     b3067 (rpoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3213047..3214888
Genome map
AA seq 613 aa AA seqDB search
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaacccgcagtcacagctgaaacttcttgtcacccgtggtaaggagcaaggc
tatctgacctatgccgaggtcaatgaccatctgccggaagatatcgtcgattcagatcag
atcgaagacatcatccaaatgatcaacgacatgggcattcaggtgatggaagaagcaccg
gatgccgatgatctgatgctggctgaaaacaccgcggacgaagatgctgccgaagccgcc
gcgcaggtgctttccagcgtggaatctgaaatcgggcgcacgactgacccggtacgcatg
tacatgcgtgaaatgggcaccgttgaactgttgacccgcgaaggcgaaattgacatcgct
aagcgtattgaagacgggatcaaccaggttcaatgctccgttgctgaatatccggaagcg
atcacctatctgctggaacagtacgatcgtgttgaagcagaagaagcgcgtctgtccgat
ctgatcaccggctttgttgacccgaacgcagaagaagatctggcacctaccgccactcac
gtcggttctgagctttcccaggaagatctggacgatgacgaagatgaagacgaagaagat
ggcgatgacgacagcgccgatgatgacaacagcatcgacccggaactggctcgcgaaaaa
tttgcggaactacgcgctcagtacgttgtaacgcgtgacaccatcaaagcgaaaggtcgc
agtcacgctaccgctcaggaagagatcctgaaactgtctgaagtattcaaacagttccgc
ctggtgccgaagcagtttgactacctggtcaacagcatgcgcgtcatgatggaccgcgtt
cgtacgcaagaacgtctgatcatgaagctctgcgttgagcagtgcaaaatgccgaagaaa
aacttcattaccctgtttaccggcaacgaaaccagcgatacctggttcaacgcggcaatt
gcgatgaacaagccgtggtcggaaaaactgcacgatgtctctgaagaagtgcatcgcgcc
ctgcaaaaactgcagcagattgaagaagaaaccggcctgaccatcgagcaggttaaagat
atcaaccgtcgtatgtccatcggtgaagcgaaagcccgccgtgcgaagaaagagatggtt
gaagcgaacttacgtctggttatttctatcgctaagaaatacaccaaccgtggcttgcag
ttccttgacctgattcaggaaggcaacatcggtctgatgaaagcggttgataaattcgaa
taccgccgtggttacaagttctccacctacgcaacctggtggatccgtcaggcgatcacc
cgctctatcgcggatcaggcgcgcaccatccgtattccggtgcatatgattgagaccatc
aacaagctcaaccgtatttctcgccagatgctgcaagagatgggccgtgaaccgacgccg
gaagaactggctgaacgtatgctgatgccggaagacaagatccgcaaagtgctgaagatc
gccaaagagccaatctccatggaaacgccgatcggtgatgatgaagattcgcatctgggg
gatttcatcgaggataccaccctcgagctgccgctggattctgcgaccaccgaaagcctg
cgtgcggcaacgcacgacgtgctggctggcctgaccgcgcgtgaagcaaaagttctgcgt
atgcgtttcggtatcgatatgaacaccgactacacgctggaagaagtgggtaaacagttc
gacgttacccgcgaacgtatccgtcagatcgaagcgaaggcgctgcgcaaactgcgtcac
ccgagccgttctgaagtgctgcgtagcttcctggacgattaa

DBGET integrated database retrieval system