KEGG   Escherichia coli K-12 MG1655: b3076Help
Entry
b3076             CDS       T00007                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase, alpha subunit (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eco00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eco00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3222633..3225725
Genome map
AA seq 1030 aa AA seqDB search
MNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLPLSGQWNFHFFDHPLQVP
EAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLS
DGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQW
ADSTYVEDQDMWWSAGIFRDVYLVGKHLTHINDFTVRTDFDEAYCDATLSCEVVLENLAA
SPVVTTLEYTLFDGERVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSAESPYLYHLVMTL
KDANGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKD
LQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDISRITDDPQW
EKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFYKHDCIQGH
YVWEWCDHGIQAQDDHGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTPGPGLKEYKQVIA
PVKIHARDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQ
ITLPQLDAREAFLNITVTKDSRTRYSEAGHPIATYQFPLKENTAQPVPFAPNNARPLTLE
DDRLSCTVRGYNFAITFSKMSGKPTSWQVNGESLLTREPKINFFKPMIDNHKQEYEGLWQ
PNHLQIMQEHLRDFAVEQSDGEVLIISRTVIAPPVFDFGMRCTYIWRIAADGQVNVALSG
ERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDIWRSTVDAMFENY
PFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAAQHCNELQRSDDI
TLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQSLASYEFGAGFF
STNLHSENKQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaacattcagctcacccacgaaaaccgacttgcgccgcgtgcgtac
tttttttcatatgattctgttgcgcaagcgcgtacctttgcccgcgaaaccagcagcctg
tttctgcccttaagcggtcagtggaatttccacttttttgaccatccgctgcaagtacca
gaagccttcacctctgagttaatggctgactgggggcatattaccgtccccgccatgtgg
caaatggaaggtcacggcaaactgcaatataccgacgaaggttttccgttccccatcgat
gtgccgtttgtccccagcgataacccaaccggtgcctatcaacgtattttcaccctcagc
gacggctggcagggtaaacagacgctgattaaatttgacggcgtcgaaacctattttgaa
gtctatgttaacggtcagtatgtgggtttcagcaagggcagtcgcctgaccgcagagttt
gacatcagcgcgatggttaaaaccggcgacaacctgttgtgtgtgcgcgtgatgcagtgg
gcggactctacctacgtggaagaccaggatatgtggtggtcagcggggatcttccgcgat
gtttatctggtcggaaaacacctaacgcatattaacgatttcactgtgcgtaccgacttt
gacgaagcctattgcgatgccacgctttcctgcgaagtggtgctggaaaatctcgccgcc
tcccctgtcgtcacgacgctggaatataccctgtttgatggcgaacgcgtggtgcacagc
agcgccattgatcatttggcaattgaaaaactgaccagcgccagctttgcttttactgtc
gaacagccgcagcaatggtcagcagaatccccttatctttaccatctggtcatgacgctg
aaagacgccaacggcaacgttctggaagtggtgccacaacgcgttggcttccgtgatatc
aaagtgcgcgacggtctgttctggatcaataaccgttatgtgatgctgcacggcgtcaac
cgtcacgacaacgatcatcgcaaaggccgcgccgttggaatggatcgcgtcgagaaagat
ctccagttgatgaagcagcacaatatcaactccgtgcgtaccgctcactacccgaacgat
ccgcgtttttacgaactgtgtgatatctacggcctgtttgtgatggcggaaaccgacgtc
gaatcgcacggctttgctaatgtcggcgatattagccgtattaccgacgatccgcagtgg
gaaaaagtctacgtcgagcgcattgttcgccatatccacgcgcagaaaaaccatccgtcg
atcatcatctggtcgctgggcaatgaatccggctatggctgtaacatccgcgcgatgtac
catgcggcgaaagcgctggatgacacgcgactggtgcattacgaagaagatcgcgatgct
gaagtggtcgatattatttccaccatgtacacccgcgtgccgctgatgaatgagtttggt
gaatacccgcatccgaagccgcgcatcatctgtgaatatgctcatgcgatggggaacgga
ccgggcgggctgacggagtaccagaacgtcttctataagcacgattgcattcagggtcat
tatgtctgggagtggtgcgaccacgggatccaggcacaggacgaccacggcaatgtctgg
tataaattcggcggcgactacggcgactatcccaacaactataacttctgtcttgatggt
ttgatctattccgatcagacgccgggaccgggcctgaaagagtacaaacaggttatcgcg
ccggtaaaaatccacgcgcgggatctgactcgcggcgagttgaaagtcgaaaataaactg
tggtttaccacgcttgatgactacaccctgcacgcagaggtgcgcgccgaaggtgaaacg
ctcgcgacgcagcagattaaactgcgcgacgttgcgccgaacagcgaagcccccttgcag
atcacgctgccgcagctggacgcccgcgaagcgttcctcaacattacggtgaccaaagat
tcccgcacccgctacagcgaagccggacaccctatcgccacttatcagttcccgctgaag
gaaaacaccgcgcagccagtgcctttcgcaccaaataatgcgcgtccgctgacgctggaa
gacgatcgtttgagctgcaccgttcgcggctacaacttcgcgatcaccttctcaaaaatg
agtggcaaaccgacatcctggcaggtgaatggcgaatcgctgctgactcgcgagccaaag
atcaacttcttcaagccgatgatcgacaaccacaagcaggagtacgaagggctgtggcaa
ccgaatcatttgcagatcatgcaggaacatctgcgcgactttgccgtagaacagagcgat
ggtgaagtgctgatcatcagccgcacagttattgccccgccggtgtttgacttcgggatg
cgctgcacctacatctggcgcatcgctgccgatggccaggttaacgtggcgctttccggc
gagcgttacggcgactatccgcacatcattccgtgcatcggtttcaccatgggaattaac
ggcgaatacgatcaggtggcgtattacggtcgtggaccgggcgaaaactacgccgacagc
cagcaggctaacatcatcgatatctggcgcagcaccgtcgatgccatgttcgagaactat
cccttcccgcagaacaacggtaaccgtcagcatgtccgctggacggcactgactaaccgc
cacggtaacggtctgctggtggttccgcagcgcccaattaacttcagcgcctggcactat
acccaggaaaacatccacgctgcccagcactgtaacgagctgcagcgcagtgatgacatc
accctgaacctcgatcaccagctgcttggcctcggctccaactcctggggcagcgaggtg
ctggactcctggcgcgtctggttccgtgacttcagctacggctttacgttgctgccggtt
tctggcggagaagctaccgcgcaaagcctggcgtcgtatgagttcggcgcagggttcttt
tccacgaatttgcacagcgagaataagcaatga

DBGET integrated database retrieval system