KEGG   Escherichia coli K-12 MG1655: b3095Help
Entry
b3095             CDS       T00007                                 

Gene name
yqjA
Definition
(RefSeq) general envelope maintenance protein; DedA family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3247773..3248435
Genome map
AA seq 220 aa AA seqDB search
MELLTQLLQALWAQDFETLANPSMIGMLYFVLFVILFLENGLLPAAFLPGDSLLVLVGVL
IAKGAMGYPQTILLLTVAASLGCWVSYIQGRWLGNTRTVQNWLSHLPAHYHQRAHHLFHK
HGLSALLIGRFIAFVRTLLPTIAGLSGLNNARFQFFNWMSGLLWVLILTTLGYMLGKTPV
FLKYEDQLMSCLMLLPVVLLVFGLAGSLVVLWKKKYGNRG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaacttttgacccaattgctgcaagccctgtgggcgcaggattttgaaaccctggcc
aatccatcgatgattggcatgttgtattttgtcttgtttgtaattttgttccttgaaaac
ggcttgcttccggcggcctttttaccgggcgacagtttactggtattggtcggcgtgttg
attgcgaaaggcgcgatgggctatccgcaaacgattctgctgctgaccgttgccgccagc
ctcggctgctgggtcagctatattcaggggcgatggctgggcaatacccgcaccgtacaa
aactggctatctcatttacccgcgcattatcatcaacgcgcacaccatctttttcataaa
cacggtttatcggcgctgttaattggtcgctttattgcgtttgtcagaacactgctgccg
acgattgccgggttatcagggctgaataacgcgcgctttcagtttttcaactggatgagc
ggtctgctgtgggtattgatcctgacaactctgggttacatgctcggcaaaacgccggta
tttttaaagtacgaggaccagctgatgtcatgcctgatgctgctcccggtggtgctgctg
gtgtttggcctggcaggttctctggtcgtgttatggaaaaagaaatatggaaatcggggg
taa

DBGET integrated database retrieval system