KEGG   Escherichia coli K-12 MG1655: b3104Help
Entry
b3104             CDS       T00007                                 

Gene name
yhaI
Definition
(RefSeq) DUF805 family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3252911..3253267
Genome map
AA seq 118 aa AA seqDB search
MQWYLSVLKNYVGFSGRARRKEYWMFTLINAIVGAIINVIQLILGLELPYLSMLYLLATF
LPVLALAIRRLHDTDRSGAWALLFFVPFIGWLVLLVFFCTEGTSGSNRYGNDPKFGSN
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggtatttgtccgtattaaaaaattatgttggtttctctggtcgcgcacgtcgt
aaagagtactggatgtttactctgattaacgccatcgtcggcgctattatcaatgtcatt
caattgattttaggtctggagcttccatatctgtctatgctttatttgctggcaaccttc
cttcccgtccttgcgcttgctatccgtcgcttacacgataccgaccgttcaggtgcctgg
gccttgctcttttttgttccgtttattggctggctcgtgcttctggtttttttctgcaca
gaaggtacttctggcagcaatcgttacggaaacgatccgaagtttggttcaaattaa

DBGET integrated database retrieval system