KEGG   Escherichia coli K-12 MG1655: b3104Help
Entry
b3104             CDS       T00007                                 

Gene name
yhaI
Definition
(RefSeq) DUF805 family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF805
Motif
Other DBs
NCBI-GeneID: 947612
NCBI-ProteinID: NP_417575
Pasteur: yhaI
RegulonDB: ECK120004171
ECOCYC: G7618
ASAP: ABE-0010211
UniProt: P64592
Position
3252911..3253267
Genome map
AA seq 118 aa AA seqDB search
MQWYLSVLKNYVGFSGRARRKEYWMFTLINAIVGAIINVIQLILGLELPYLSMLYLLATF
LPVLALAIRRLHDTDRSGAWALLFFVPFIGWLVLLVFFCTEGTSGSNRYGNDPKFGSN
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggtatttgtccgtattaaaaaattatgttggtttctctggtcgcgcacgtcgt
aaagagtactggatgtttactctgattaacgccatcgtcggcgctattatcaatgtcatt
caattgattttaggtctggagcttccatatctgtctatgctttatttgctggcaaccttc
cttcccgtccttgcgcttgctatccgtcgcttacacgataccgaccgttcaggtgcctgg
gccttgctcttttttgttccgtttattggctggctcgtgcttctggtttttttctgcaca
gaaggtacttctggcagcaatcgttacggaaacgatccgaagtttggttcaaattaa

DBGET integrated database retrieval system