KEGG   Escherichia coli K-12 MG1655: b3125Help
Entry
b3125             CDS       T00007                                 

Gene name
garR
Definition
(RefSeq) tartronate semialdehyde reductase (EC:1.1.1.60)
  KO
K00042  
2-hydroxy-3-oxopropionate reductase [EC:1.1.1.60]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b3125 (garR)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.60  2-hydroxy-3-oxopropionate reductase
     b3125 (garR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3271867..3272751)
Genome map
AA seq 294 aa AA seqDB search
MKVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVIAAGAETASTAKAIAEQCDVI
ITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPV
SGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGEIGAGNVTKLANQVIVALN
IAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDL
ANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALACYYEKLAKVEVTR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttggttttattggcctggggattatgggtaaaccaatgagtaaaaaccttctg
aaagcaggttactcgctggtggttgctgaccgtaacccagaagctattgctgacgtgatt
gctgcaggtgcagaaacagcgtctacggctaaagcgatcgctgaacagtgcgacgtcatc
ataaccatgctgccaaactcccctcatgtgaaagaggtggcgctgggtgagaatggcatt
attgaaggcgcgaagccaggtacggtattgatcgatatgagttctatcgcaccgctggca
agccgtgaaatcagcgaagcgctgaaagcgaaaggcattgatatgctggatgctccggtg
agcggcggtgaaccgaaagccatcgacggtacgctgtcagtgatggtgggcggcgacaag
gctattttcgacaaatactatgatttgatgaaagcgatggcgggttccgtggtgcatacc
ggggaaatcggtgcaggtaacgtcaccaaactggcaaatcaggtcattgtggcgctgaat
attgccgcgatgtcagaagcgttaacgctggcaactaaagcgggcgttaacccggacctg
gtttatcaggcaattcgcggtggactggcgggcagtaccgtgctggatgccaaagcgccg
atggtgatggaccgcaacttcaagccgggcttccgtattgatctgcatattaaggatctg
gcgaatgcgctggatacttctcacggcgtcggcgcacaactgccgctcacagctgcggtt
atggagatgatgcaggcactgcgagcagatggtttaggaacggcggatcatagcgccctg
gcgtgctactacgaaaaactggcgaaagtcgaagttactcgttaa

DBGET integrated database retrieval system