KEGG   Escherichia coli K-12 MG1655: b3138Help
Entry
b3138             CDS       T00007                                 

Gene name
agaB
Definition
(RefSeq) N-acetylgalactosamine-specific enzyme IIB component of PTS (EC:2.7.1.69)
  KO
K10984  
PTS system, galactosamine-specific IIB component [EC:2.7.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Galactose metabolism
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    b3138 (agaB)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b3138 (agaB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     b3138 (agaB)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Galactosamine-specific II component [MD:M00287]
    b3138 (agaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3284170..3284646
Genome map
AA seq 158 aa AA seqDB search
MTSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFG
IRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQIS
SKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtccaaatattctcttaacccgtattgataaccgtctggttcacggtcaggtt
ggcgtgacctggacatccaccatcggtgcaaatctgctggtagtcgtggatgatgttgtc
gctaacgatgatattcaacagaaattaatgggtattaccgcggaaacctacggctttggc
attcgtttctttactatcgaaaaaaccattaacgtcatcggcaaagctgcaccacatcag
aagatcttcctgatttgccgtacgccacaaacggtacgtaaattggtagaaggtggtatt
gacctgaaagatgtcaacgtcggcaatatgcatttctcggaagggaaaaagcaaatcagc
agtaaagtttatgtcgatgaccaggatctcacggacttacgttttattaaacaacgtggc
gtgaatgttttcattcaggacgtccctggcgatcaaaaagaacaaatccctgactaa

DBGET integrated database retrieval system