KEGG   Escherichia coli K-12 MG1655: b3140Help
Entry
b3140             CDS       T00007                                 

Gene name
agaD
Definition
(RefSeq) N-acetylgalactosamine-specific enzyme IID component of PTS (EC:2.7.1.69)
  KO
K10986  
PTS system, galactosamine-specific IID component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Galactose metabolism
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    b3140 (agaD)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b3140 (agaD)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Galactosamine-specific II component [MD:M00287]
    b3140 (agaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3285478..3286269
Genome map
AA seq 263 aa AA seqDB search
MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKDDKPGLSAAMKDN
LEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAG
ICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATIL
GITVIGGLIASYVHINVVTSFAIDNTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKK
AHPVLLIGVTFVLSIVCSAFGIL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggatctgaaatcagtaaaaaagatatcacccgtctgggctttcgttcgtcgctgctg
caagcgagctttaactacgaaaggatgcaggcgggcggttttacctgggcgatgttgccg
atcctgaaaaagatttataaggacgacaaaccgggcttaagcgcggcgatgaaagataac
ctcgaatttattaatacccacccgaatctggtcggattcctgatggggttattaatttcg
atggaagaaaaaggagaaaaccgcgacaccattaaaggcctcaaagtggcactgtttggc
ccaatcgccgggattggcgatgcgattttctggtttactttgttgccgattatggcggga
atttgctcatcatttgccagccagggaaacctgctggggccgattctatttttcgccgtt
tacctgcttatctttttcctgcgcgtcggctggacccacgtcggttattcagtcggcgtg
aaggcgatcgataaagtgcgagagaactcgcagatgattgcccgttcggcaaccatcctc
gggatcacggtaatcggcgggctgatcgcttcgtatgtgcatattaacgtggtgacatcg
tttgccatcgacaatacccacagcgttgcgctgcagcaggatttcttcgataaagtcttc
ccgaacattttaccgatggcctacaccctgctgatgtattacttcctgcgggtgaaaaaa
gcgcatccggtgctgttaatcggcgtgacttttgtgctctctattgtttgttccgcattc
ggcattttgtaa

DBGET integrated database retrieval system