KEGG   Escherichia coli K-12 MG1655: b3175Help
Entry
b3175             CDS       T00007                                 

Gene name
secG
Definition
(RefSeq) preprotein translocase membrane subunit
  KO
K03075  
preprotein translocase subunit SecG
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    b3175 (secG)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b3175 (secG)
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    b3175 (secG)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   b3175 (secG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3322173..3322505)
Genome map
AA seq 110 aa AA seqDB search
MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA
TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagctcttttagtagttttccttattgtggcaattggccttgttggtctgatc
atgctgcagcaaggtaaaggcgctgatatgggagcctccttcggagcaggcgcttccgct
acgctgtttggttcaagtggttctggtaacttcatgacccgcatgacggcgctgctggca
acgttattcttcatcatcagtctggtgctgggtaacatcaatagcaacaaaaccaataaa
ggtagcgaatgggaaaatctgagtgcaccggcgaaaaccgaacaaactcagccagctgct
ccggctaagccgaccagcgatatcccgaactaa

DBGET integrated database retrieval system