KEGG   Escherichia coli K-12 MG1655: b3175Help
Entry
b3175             CDS       T00007                                 

Gene name
secG
Definition
(RefSeq) preprotein translocase membrane subunit
  KO
K03075  
preprotein translocase subunit SecG
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    b3175 (secG)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b3175 (secG)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   b3175 (secG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3322173..3322505)
Genome map
AA seq 110 aa AA seqDB search
MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA
TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagctcttttagtagttttccttattgtggcaattggccttgttggtctgatc
atgctgcagcaaggtaaaggcgctgatatgggagcctccttcggagcaggcgcttccgct
acgctgtttggttcaagtggttctggtaacttcatgacccgcatgacggcgctgctggca
acgttattcttcatcatcagtctggtgctgggtaacatcaatagcaacaaaaccaataaa
ggtagcgaatgggaaaatctgagtgcaccggcgaaaaccgaacaaactcagccagctgct
ccggctaagccgaccagcgatatcccgaactaa

DBGET integrated database retrieval system