KEGG   Escherichia coli K-12 MG1655: b3189Help
Entry
b3189             CDS       T00007                                 

Gene name
murA
Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00520  Amino sugar and nucleotide sugar metabolism
eco00550  Peptidoglycan biosynthesis
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    b3189 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    b3189 (murA)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     b3189 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   b3189 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Phage_gp49_66
Motif
Other DBs
NCBI-GeneID: 947703
NCBI-ProteinID: NP_417656
Pasteur: murA
RegulonDB: ECK120001327
ECOCYC: EG11358
ASAP: ABE-0010479
UniProt: P0A749
Structure
PDB: 

Jmol
Position
complement(3335235..3336494)
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL
SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgttcaggggccaacgaagctccagggcgaagtcacaatttccggc
gctaaaaatgctgctctgcctatcctttttgccgcactactggcggaagaaccggtagag
atccagaacgtcccgaaactgaaagacgtcgatacatcaatgaagctgctaagccagctg
ggtgcgaaagtagaacgtaatggttctgtgcatattgatgcccgcgacgttaatgtattc
tgcgcaccttacgatctggttaaaaccatgcgtgcttctatctgggcgctggggccgctg
gtagcgcgctttggtcaggggcaagtttcactacctggcggttgtacgatcggtgcgcgt
ccggttgatctacacatttctggcctcgaacaattaggcgcgaccatcaaactggaagaa
ggttacgttaaagcttccgtcgatggtcgtttgaaaggtgcacatatcgtgatggataaa
gtcagcgttggcgcaacggtgaccatcatgtgtgctgcaaccctggcggaaggcaccacg
attattgaaaacgcagcgcgtgaaccggaaatcgtcgataccgcgaacttcctgattacg
ctgggtgcgaaaattagcggtcagggcaccgatcgtatcgtcatcgaaggtgtggaacgt
ttaggcggcggtgtctatcgcgttctgccggatcgtatcgaaaccggtactttcctggtg
gcggcggcgatttctcgcggcaaaattatctgccgtaacgcgcagccagatactctcgac
gccgtgctggcgaaactgcgtgacgctggagcggacatcgaagtcggcgaagactggatt
agcctggatatgcatggcaaacgtccgaaggctgttaacgtacgtaccgcgccgcatccg
gcattcccgaccgatatgcaggcccagttcacgctgttgaacctggtggcagaagggacc
gggtttatcaccgaaacggtctttgaaaaccgctttatgcatgtgccagagctgagccgt
atgggcgcgcacgccgaaatcgaaagcaataccgttatttgtcacggtgttgaaaaactt
tctggcgcacaggttatggcaaccgatctgcgtgcatcagcaagcctggtgctggctggc
tgtattgcggaagggacgacggtggttgatcgtatttatcacatcgatcgtggctacgaa
cgcattgaagacaaactgcgcgctttaggtgcaaatattgagcgtgtgaaaggcgaataa

DBGET integrated database retrieval system