KEGG   Escherichia coli K-12 MG1655: b3194Help
Entry
b3194             CDS       T00007                                 

Gene name
mlaE
Definition
(RefSeq) ABC transporter maintaining OM lipid asymmetry, inner membrane permease protein
  KO
K02066  
phospholipid/cholesterol/gamma-HCH transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3194 (mlaE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter [MD:M00669]
    b3194 (mlaE)
   Phospholipid transporter [MD:M00210]
    b3194 (mlaE)
   Mce system transporter [MD:M00670]
    b3194 (mlaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3338466..3339248)
Genome map
AA seq 260 aa AA seqDB search
MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV
VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI
GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI
DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV
HSSLAVLGLDFVLTALMFGN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaaatgcgctggcgtcgctcggacataaagggattaaaaccctgagaacgttc
gggcgggccgggttaatgttattcaatgcgctggtcggcaaaccggaatttcgcaaacat
gcgccgctgctggtgcgccagctctataatgtcggcgtcctgtcgatgctgattattgtg
gtttctggcgtgttcatcggaatggtgttggggctgcaaggttatctggttctgaccact
tatagtgcggaaaccagtctgggtatgctggtggcgttatcgctactgcgtgaactgggg
ccggtggttgccgcgttgttgtttgccgggcgtgctggttcggcgctaaccgcagaaatc
ggcctgatgcgcgctacagagcaactctccagtatggagatgatggcggtggatccgctg
cgtcgggttatttctccccgtttctgggctggggttatttcattaccactgttgacggtt
attttcgtcgccgtggggatctggggcggatctctggtcggcgtcagttggaaaggcatt
gatagcgggttcttctggtcggcaatgcaaaatgccgtcgactggcgtatggatctggtc
aactgtctgattaagagcgtggtgttcgccatcacggtgacgtggatttcgttgtttaac
ggctacgacgccatcccgacgtctgccgggattagccgggcaaccactcgcaccgttgtc
cactcgtctctggctgttctggggctggattttgtgctgaccgcattgatgtttgggaat
tga

DBGET integrated database retrieval system