KEGG   Escherichia coli K-12 MG1655: b3196Help
Entry
b3196             CDS       T00007                                 

Gene name
yrbG
Definition
(RefSeq) putative calcium/sodium:proton antiporter
  KO
K07301  
cation:H+ antiporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3196 (yrbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3340275..3341252
Genome map
AA seq 325 aa AA seqDB search
MLLATALLIVGLLLVVYSADRLVFAASILCRTFGIPPLIIGMTVVSIGTSLPEVIVSLAA
SLHEQRDLAVGTALGSNIINILLILGLAALVRPFTVHSDVLRRELPLMLLVSVVAGSVLY
DGQLSRSDGIFLLFLAVLWLLFIVKLARQAERQGTDSLTREQLAELPRDGGLPVAFLWLG
IALIIMPVATRMVVDNATVLANYFAISELTMGLTAIAIGTSLPELATAIAGVRKGENDIA
VGNIIGANIFNIVIVLGLPALITPGEIDPLAYSRDYSVMLLVSIIFALLCWRRSPQPGRG
VGVLLTGGFIVWLAMLYWLSPILVE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcttttagctacggcactgttaattgttggtttacttttggtcgtttacagtgccgac
cgcctggtttttgccgcgtctattctttgccgaacctttggcatcccgccgctgatcatc
ggcatgacggtggtcagtattggtacatcgttaccagaagtcatcgtctcgcttgccgcg
tctctgcacgaacaacgcgatttagccgttggtacagccctcggctcaaacattatcaat
atattgctgatcctcggtctggctgcgctggttcgtccttttaccgtccattctgatgtt
ctacgccgtgaattacccttaatgttgttggtcagcgtggtggccggttccgtactctat
gacggacaacttagtcgcagcgatggtatctttctcctctttctggctgtgctatggctg
ctgttcattgttaaacttgcacgtcaggctgaacgtcaggggactgacagcctgaccaga
gagcagcttgcagagctgccgcgtgacggcggattgcccgtcgcgtttttatggctcggc
attgcgcttatcatcatgccagtggccacgcggatggtggttgataacgccacggtgctg
gcgaattactttgccatcagcgagttgacgatgggtctgacggcaattgctatcggaacc
agcctgccggaactggcaaccgcaatagcgggggttcgcaaaggtgaaaacgacattgct
gtcggaaatatcattggcgcaaacatttttaatattgtcatcgtgttgggtttacccgcg
ctgataacgccaggagagattgatccactggcgtacagtcgtgactacagcgtgatgttg
ctggtgagcattatttttgcgttgctgtgctggcggcgctccccgcaaccgggccgtggt
gtaggggtattattaactggcggatttatcgtatggctggcgatgttgtactggttatcg
ccaatactcgttgaataa

DBGET integrated database retrieval system