KEGG   Escherichia coli K-12 MG1655: b3206Help
Entry
b3206             CDS       T00007                                 

Gene name
npr
Definition
(RefSeq) phosphohistidinoprotein-hexose phosphotransferase component of N-regulated PTS system (Npr)
  KO
K08485  
phosphocarrier protein NPr
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b3206 (npr)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    b3206 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3347966..3348238
Genome map
AA seq 90 aa AA seqDB search
MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKG
RQIEVEATGPQEEEALAAVIALFNSGFDED
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaagcaaactgttgaaatcacaaacaagctgggcatgcatgcccggcctgca
atgaagctgtttgaattaatgcagggttttgacgctgaagtgctcttacgtaatgacgaa
ggcaccgaggctgaagccaacagcgttattgcgctgctgatgttggattctgccaaagga
cggcagattgaagttgaagcgaccggtccacaggaagaggaagcactggccgccgttatc
gccctctttaattctggttttgatgaagattaa

DBGET integrated database retrieval system