KEGG   Escherichia coli K-12 MG1655: b3219Help
Entry
b3219             CDS       T00007                                 

Gene name
yhcF
Definition
(RefSeq) putative transcriptional regulator
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3366926..3367642
Genome map
AA seq 238 aa AA seqDB search
MNNVKLLIAGSAFFAMSAQAADRVSIDVKVTLEAAACTPILSNGGVVNFGSHSVNRLSTQ
HYTQIGTRNINMTITCESATGIAITARDTRMDSMTTGKDSGGQSGVKYTLNGGGYISQTT
RLFGLGKTKDNKNIGSYAVLIDSNNISASNGSQTLAVSIAGADAVITGQKRAWQTLTAYP
LAVDQSYYYTFVKPGETTPTPVTNAIIPLQVSASIANDLGGSEKIELDGKAVISVVYL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgtaaaattactgattgccggaagtgccttttttgccatgtcagcgcaagcc
gctgatagagtatcaattgacgttaaggtgactctggaagctgcagcttgtactccaata
ctaagcaacggcggagttgttaacttcggtagtcattcagtcaatagactttcaacgcag
cactacacacagattggaacacgtaatattaatatgactataacttgcgaatccgctacc
ggcattgcgattaccgctcgtgatacacgaatggatagtatgaccaccggaaaagatagt
gggggtcagagtggtgtaaaatataccttaaatggcggaggttatattagccagacaacg
cgcttattcggcttagggaaaacaaaagataataaaaatatcggtagttatgccgtgtta
attgatagcaacaacattagtgccagcaatggtagccagacgttagctgtatcaatagca
ggtgcagatgccgtcataacagggcaaaaaagagcatggcaaacgctcaccgcttatccg
cttgcagtcgatcaaagctattattacacctttgtaaaaccaggtgaaacaaccccaact
cctgtaacgaacgccattataccgcttcaggtgagcgcatctatcgcgaatgatttaggc
ggttcagaaaaaatcgaacttgatgggaaagctgtgataagcgtagtctacttgtga

DBGET integrated database retrieval system