KEGG   Escherichia coli K-12 MG1655: b3222Help
Entry
b3222             CDS       T00007                                 

Gene name
nanK
Definition
(RefSeq) N-acetylmannosamine kinase
  KO
K00885  N-acylmannosamine kinase [EC:2.7.1.60]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00520  Amino sugar and nucleotide sugar metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    b3222 (nanK)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.60  N-acylmannosamine kinase
     b3222 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Pan_kinase DUF2173 HHH_5
Motif
Other DBs
NCBI-GeneID: 947757
NCBI-ProteinID: NP_417689
Pasteur: yhcI
RegulonDB: ECK120004223
ECOCYC: G7676
ASAP: ABE-0010571
UniProt: P45425
Structure
PDB: 

Jmol
Position
complement(3369475..3370350)
Genome map
AA seq 291 aa AA seqDB search
MTTLAIDIGGTKLAAALIGADGQIRDRRELPTPASQTPEALRDALSALVSPLQAHAQRVA
IASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAQAAAWAEFQALDGD
ITDMVFITVSTGVGGGVVSGCKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIASG
RGIAAAAQGELAGADAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVG
GSVGLAEGYLALVETYLAQEPAAFHVDLLAAHYRHDAGLLGAALLAQGEKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactggcgattgatatcggcggtactaaacttgccgccgcgctgattggcgct
gacgggcagatccgcgatcgtcgtgaacttcctacgccagccagccagacaccagaagcc
ttgcgtgatgccttatccgcattagtctctccgttgcaagctcatgcgcagcgggttgcc
atcgcttcgaccgggataatccgtgacggcagcttgctggcgcttaatccgcataatctt
ggtggattgctacactttccgttagtcaaaacgctggaacaacttaccaatttgccgacc
attgccattaacgacgcgcaggccgcagcatgggcggagtttcaggcgctggatggcgat
ataaccgatatggtctttatcaccgtttccaccggcgttggcggcggtgtagtgagcggc
tgcaaactgcttaccggccctggcggtctggcggggcatatcgggcatacgcttgccgat
ccacacggcccagtctgcggctgtggacgcacaggttgcgtggaagcgattgcttctggt
cgcggcattgcagcggcagcgcagggggagttggctggcgcggatgcgaaaactattttc
acgcgcgccgggcagggtgacgagcaggcgcagcagctgattcaccgctccgcacgtacg
cttgcaaggctgatcgctgatattaaagccacaactgattgccagtgcgtggtggtcggt
ggcagcgttggtctggcagaagggtatctggcgctggtggaaacgtatctggcgcaggag
ccagcggcatttcatgttgatttactggcggcgcattaccgccatgatgcaggtttactt
ggggctgcgctgttggcccagggagaaaaattatga

DBGET integrated database retrieval system