KEGG   Escherichia coli K-12 MG1655: b3222Help
Entry
b3222             CDS       T00007                                 

Gene name
nanK
Definition
(RefSeq) N-acetylmannosamine kinase
  KO
K00885  
N-acylmannosamine kinase [EC:2.7.1.60]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    b3222 (nanK)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.60  N-acylmannosamine kinase
     b3222 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3369475..3370350)
Genome map
AA seq 291 aa AA seqDB search
MTTLAIDIGGTKLAAALIGADGQIRDRRELPTPASQTPEALRDALSALVSPLQAHAQRVA
IASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAQAAAWAEFQALDGD
ITDMVFITVSTGVGGGVVSGCKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIASG
RGIAAAAQGELAGADAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVG
GSVGLAEGYLALVETYLAQEPAAFHVDLLAAHYRHDAGLLGAALLAQGEKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactggcgattgatatcggcggtactaaacttgccgccgcgctgattggcgct
gacgggcagatccgcgatcgtcgtgaacttcctacgccagccagccagacaccagaagcc
ttgcgtgatgccttatccgcattagtctctccgttgcaagctcatgcgcagcgggttgcc
atcgcttcgaccgggataatccgtgacggcagcttgctggcgcttaatccgcataatctt
ggtggattgctacactttccgttagtcaaaacgctggaacaacttaccaatttgccgacc
attgccattaacgacgcgcaggccgcagcatgggcggagtttcaggcgctggatggcgat
ataaccgatatggtctttatcaccgtttccaccggcgttggcggcggtgtagtgagcggc
tgcaaactgcttaccggccctggcggtctggcggggcatatcgggcatacgcttgccgat
ccacacggcccagtctgcggctgtggacgcacaggttgcgtggaagcgattgcttctggt
cgcggcattgcagcggcagcgcagggggagttggctggcgcggatgcgaaaactattttc
acgcgcgccgggcagggtgacgagcaggcgcagcagctgattcaccgctccgcacgtacg
cttgcaaggctgatcgctgatattaaagccacaactgattgccagtgcgtggtggtcggt
ggcagcgttggtctggcagaagggtatctggcgctggtggaaacgtatctggcgcaggag
ccagcggcatttcatgttgatttactggcggcgcattaccgccatgatgcaggtttactt
ggggctgcgctgttggcccagggagaaaaattatga

DBGET integrated database retrieval system