KEGG   Escherichia coli K-12 MG1655: b3224Help
Entry
b3224             CDS       T00007                                 

Gene name
nanT
Definition
(RefSeq) sialic acid transporter
  KO
K03290  
MFS transporter, SHS family, sialic acid transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Sialate:H+ symporter (SHS) family [TC:2.A.1.12]
    b3224 (nanT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3371084..3372574)
Genome map
AA seq 496 aa AA seqDB search
MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLTEVQGEFGLTTVQAASL
ISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGM
GMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIG
ILPIIFALWLRKNIPEAEDWKEKHAGKAPVRTMVDILYRGEHRIANIVMTLAAATALWFC
FAGNLQNAAIVAVLGLLCAAIFISFMVQSAGKRWPTGVMLMVVVLFAFLYSWPIQALLPT
YLKTDLAYNPHTVANVLFFSGFGAAVGCCVGGFLGDWLGTRKAYVCSLLASQLLIIPVFA
IGGANVWVLGLLLFFQQMLGQGIAGILPKLIGGYFDTDQRAAGLGFTYNVGALGGALAPI
IGALIAQRLDLGTALASLSFSLTFVVILLIGLDMPSRVQRWLRPEALRTHDAIDGKPFSG
AVPFGSAKNDLVKTKS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtactacaacccagaatatcccgtggtatcgccatctcaaccgtgcacaatggcgc
gcattttccgctgcctggttgggatatctgcttgacggttttgatttcgttttaatcgcc
ctggtactcaccgaagtacaaggtgaattcgggctgacgacggtgcaggcggcaagtctg
atctctgcagcctttatctctcgctggttcggcggcctgatgctcggcgctatgggtgac
cgctacgggcgtcgtctggcaatggtcaccagcatcgttctcttctcggccgggacgctg
gcctgcggctttgcgccaggctacatcaccatgtttatcgctcgtctggtcatcggcatg
gggatggcgggtgaatacggttccagcgccacctatgtcattgaaagctggccaaaacat
ctgcgtaacaaagccagtggttttttgatttcaggcttctctgtgggggccgtcgttgcc
gctcaggtctatagcctggtggttccggtctggggctggcgtgcgctgttctttatcggc
attttgccaatcatctttgctctctggctgcgtaaaaacatcccggaagcggaagactgg
aaagagaaacacgcaggtaaagcaccagtacgcacaatggtggatattctctaccgtggt
gaacatcgcattgccaatatcgtaatgacactggcggcggctactgcgctgtggttctgc
ttcgccggtaacctgcaaaatgccgcgatcgtcgctgttcttgggctgttatgcgccgca
atctttatcagctttatggtgcagagtgcaggcaaacgctggccaacgggcgtaatgctg
atggtggtcgtgttgtttgctttcctctactcatggccgattcaggcgctgctgccaacg
tatctgaaaaccgatctggcttataacccgcatactgtagccaatgtgctgttctttagt
ggctttggcgcggcggtgggatgctgcgtaggtggcttcctcggtgactggctgggaacc
cgcaaagcgtacgtttgtagcctgctggcctcgcagctgctgattattccggtatttgcg
attggcggcgcaaacgtctgggtgctcggtctgttactgttcttccagcaaatgcttgga
caagggatcgccgggatcttaccaaaactgattggcggttatttcgataccgaccagcgt
gcagcgggcctgggctttacctacaacgttggcgcattgggcggtgcactggccccaatc
atcggcgcgttgatcgctcaacgtctggatctgggtactgcgctggcatcgctctcgttc
agtctgacgttcgtggtgatcctgctgattgggctggatatgccttctcgcgttcagcgt
tggttgcgcccggaagcgttgcgtactcatgacgctatcgacggtaaaccattcagcggt
gccgtgccgtttggcagcgccaaaaacgatttagtcaaaaccaaaagttaa

DBGET integrated database retrieval system