KEGG   Escherichia coli K-12 MG1655: b3227Help
Entry
b3227             CDS       T00007                                 

Gene name
dcuD
Definition
(RefSeq) putative transporter
  KO
K03326  
C4-dicarboxylate transporter, DcuC family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3227 (dcuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3374869..3376236
Genome map
AA seq 455 aa AA seqDB search
MFGIIISVIVLITMGYLILKNYKPQVVLAAAGIFLMMCGVWLGFGGVLDPTKSSGYLIVD
IYNEILRMLSNRIAGLGLSIMAVGGYARYMERIGASRAMVSLLSRPLKLIRSPYIILSAT
YVIGQIMAQFITSASGLGMLLMVTLFPTLVSLGVSRLSAVAVIATTMSIEWGILETNSIF
AAQVAGMKIATYFFHYQLPVASCVIISVAISHFFVQRAFDKKDKNINHEQAEQKALDNVP
PLYYAILPVMPLILMLGSLFLAHVGLMQSELHLVVVMLLSLTVTMFVEFFRKHNLRETMD
DVQAFFDGMGTQFANVVTLVVAGEIFAKGLTTIGTVDAVIRGAEHSGLGGIGVMIIMALV
IAICAIVMGSGNAPFMSFASLIPNIAAGLHVPAVVMIMPMHFATTLARAVSPITAVVVVT
SGIAGVSPFAVVKRTAIPMAVGFVVNMIATITLFY
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcataattatatctgtcatcgtattaattacgatgggctatttgatcctgaaa
aactacaaacctcaggtggtgctggctgccgcaggtatcttcctgatgatgtgcggtgtc
tggttagggttcggtggtgtactcgatcccaccaaaagcagcggctacttgatcgtcgat
atttataatgaaatcctgcgcatgctgtccaaccgcattgccggattggggctgtcgatt
atggcggtgggcggttatgcccgctacatggagcgcataggggccagtcgcgcgatggtg
agcttgttaagccgcccgttaaaactcattcgctcgccgtatattattctgtcggcaact
tacgtcatcggccaaatcatggcgcagtttattaccagcgcctccggtctgggtatgttg
ctgatggtcaccttatttccgacgctggtgagtctgggagtaagtcgtctctctgcggtg
gcagttatcgcaaccacgatgtccattgagtgggggattctggaaacgaactccattttt
gctgcccaggtagcgggaatgaaaattgccacatacttcttccactaccagcttccggtc
gcctcttgcgtcattatctcggtggcgatctcccactttttcgtgcaacgcgcttttgac
aaaaaagataaaaatatcaatcacgaacaggcagagcaaaaagctctcgataatgtcccg
ccgctctattacgccattttacctgtgatgccgttaatcctgatgctcggctcgctgttc
ctcgcccacgtcgggctgatgcagtcagaactgcatctggtggtggtgatgttactgagt
ttgactgtgacgatgtttgttgagttcttccgcaagcataacttgcgcgaaacaatggac
gatgtgcaggcgttttttgacggcatgggtacgcagtttgccaacgtggtaacgctggtg
gtcgcgggtgaaatatttgcgaaaggcttaacgacgattggcactgtcgatgcggttatc
aggggggcggagcattctggtctgggcggtattggcgtgatgattattatggcgctggtc
attgccatttgtgccattgtgatgggctctggcaatgcgccgtttatgtcatttgccagt
cttattccgaatatcgcagccggactacatgtaccagcggttgtaatgattatgccgatg
cattttgccacgacgctagcgcgcgcggtttcgccgattactgcggtggtggtcgttacg
tcaggaattgcaggcgtttcgccttttgcggtggtgaagcggacagcgatccccatggca
gtcggtttcgtggtgaatatgattgccacaatcacgctattttattaa

DBGET integrated database retrieval system