KEGG   Escherichia coli K-12 MG1655: b3229Help
Entry
b3229             CDS       T00007                                 

Gene name
sspA
Definition
(RefSeq) stringent starvation protein A, phage P1 late gene activator, RNAP-associated acid-resistance protein, inactive glutathione S-transferase homolog
  KO
K03599  
RNA polymerase-associated protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription machinery [BR:eco03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     b3229 (sspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3376782..3377420)
Genome map
AA seq 212 aa AA seqDB search
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIING
SASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGPGA
KELKGYMTRVFERDSFLASLTEAEREMRLGRS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctgccaacaaacgttcggtaatgacgctgttttccggtcctactgacatc
tatagccatcaggtccgcattgtgctggctgagaaaggtgtaagtttcgagatcgaacac
gtggaaaaggacaatccgcctcaggatctgattgacctcaacccgaatcagagcgttccg
accctggtggatcgtgagctgaccctgtgggaatctcgcatcattatggaatatctggat
gagcgtttcccgcatccgccactgatgcctgtttacccggtagctcgcggtgaaagccgt
ctgtacatgcatcgcatcgaaaaagactggtacacgctgatgaacaccatcatcaacggt
tcagcttctgaagcagatgccgcacgtaagcaactgcgcgaagaactgctggcgattgcg
ccggtcttcggtcagaagccgtacttcctgagcgatgagttcagcctggtcgattgctat
cttgctccgctgctgtggcgtctgccgcaactgggcatcgagttcagcggcccgggtgcg
aaagagctgaaaggctatatgacccgcgtctttgagcgtgactctttccttgcttcttta
actgaagcagaacgtgaaatgcgtctgggccggagttaa

DBGET integrated database retrieval system