KEGG   Escherichia coli K-12 MG1655: b3237Help
Entry
b3237             CDS       T00007                                 

Gene name
argR
Definition
(RefSeq) l-arginine-responsive arginine metabolism regulon transcriptional regulator
  KO
K03402  transcriptional regulator of arginine metabolism
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    b3237 (argR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arg_repressor Arg_repressor_C Rhabdo_ncap_2 DUF4911 AAA_22
Motif
Other DBs
NCBI-GeneID: 947861
NCBI-ProteinID: NP_417704
Pasteur: argR
RegulonDB: ECK120000066
ECOCYC: EG10070
ASAP: ABE-0010620
UniProt: P0A6D0
Structure
PDB: 

Jmol
Position
3384703..3385173
Genome map
AA seq 156 aa AA seqDB search
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRN
AKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEG
ILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagctcggctaagcaagaagaactagttaaagcatttaaagcattacttaaagaa
gagaaatttagctcccagggcgaaatcgtcgccgcgttgcaggagcaaggctttgacaat
attaatcagtctaaagtctcgcggatgttgaccaagtttggtgctgtacgtacacgcaat
gccaaaatggaaatggtttactgcctgccagctgaactgggtgtaccaaccacctccagt
ccattgaagaatctggtgctggatatcgactacaacgatgcagttgtcgtgattcatacc
agccctggcgcggcgcagttaattgctcgcctgctggactcactgggcaaagcagaaggt
attctgggcaccatcgctggcgatgacaccatctttaccacccctgctaacggtttcaca
gtcaaagacctgtacgaagcgattttagagctgttcgaccaggagctttaa

DBGET integrated database retrieval system