KEGG   Escherichia coli K-12 MG1655: b3237Help
Entry
b3237             CDS       T00007                                 

Gene name
argR
Definition
(RefSeq) l-arginine-responsive arginine metabolism regulon transcriptional regulator
  KO
K03402  
transcriptional regulator of arginine metabolism
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    b3237 (argR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3384703..3385173
Genome map
AA seq 156 aa AA seqDB search
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRN
AKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEG
ILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagctcggctaagcaagaagaactagttaaagcatttaaagcattacttaaagaa
gagaaatttagctcccagggcgaaatcgtcgccgcgttgcaggagcaaggctttgacaat
attaatcagtctaaagtctcgcggatgttgaccaagtttggtgctgtacgtacacgcaat
gccaaaatggaaatggtttactgcctgccagctgaactgggtgtaccaaccacctccagt
ccattgaagaatctggtgctggatatcgactacaacgatgcagttgtcgtgattcatacc
agccctggcgcggcgcagttaattgctcgcctgctggactcactgggcaaagcagaaggt
attctgggcaccatcgctggcgatgacaccatctttaccacccctgctaacggtttcaca
gtcaaagacctgtacgaagcgattttagagctgttcgaccaggagctttaa

DBGET integrated database retrieval system