KEGG   Escherichia coli K-12 MG1655: b3241Help
Entry
b3241             CDS       T00007                                 

Gene name
aaeA
Definition
(RefSeq) p-hydroxybenzoic acid efflux system component
  KO
K15548  p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b3241 (aaeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl_2 HlyD_D23 HlyD_3 HlyD Biotin_lipoyl DUF3156 BLOC1S3 OppC_N
Motif
Other DBs
NCBI-GeneID: 947748
NCBI-ProteinID: NP_417708
Pasteur: yhcQ
RegulonDB: ECK120004233
ECOCYC: G7686
ASAP: ABE-0010631
UniProt: P46482
Position
complement(3388194..3389126)
Genome map
AA seq 310 aa AA seqDB search
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ
VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS
REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS
TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR
DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR
KMAHRLREFG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacactaataagaaaattctcccgtacggccatcacggtcgtattagtcattctg
gccttcatcgcaatttttaatgcctgggtctattacaccgaatccccctggacgcgtgac
gcgcgctttagcgctgacgtcgttgcgatcgcgccggacgtttctggactcattacccag
gtgaatgttcatgataaccagctggtgaaaaaaggacagatactgttcaccatcgaccag
ccgcgctatcaaaaggcgcttgaggaagcgcaagccgatgttgcttattatcaggtactg
gcacaggagaaacgccaggaggccggacgtcgtaaccgtctcggtgtgcaggcgatgtct
cgcgaagagatcgaccaggccaacaacgtactacaaacggttctgcatcagttagcgaaa
gcgcaggcgacccgcgatctggcaaaactggatcttgaacgcacggtgatccgcgcgcca
gcagatggctgggtgaccaacctcaacgtctataccggtgagtttattactcgaggatca
acggcggttgcgctggtgaaacagaactccttctatgtactggcctatatggaagaaact
aagctggaaggggtgcgtccggggtatcgtgcagagatcacgccgcttggcagtaacaaa
gtgctgaaagggactgttgatagtgttgccgcaggggtcaccaacgccagcagcacgcgt
gacgacaaagggatggcgactatagactctaaccttgaatgggtgcgtcttgcgcaacgt
gttccggttcgtattcgtctcgacaaccagcaagagaacatctggcctgcgggcaccact
gctacagtggtggtcactggcaaacaagatcgcgacgaaagccaggattcgttcttccgt
aaaatggcccatcgcctgcgtgagtttggttaa

DBGET integrated database retrieval system