KEGG   Escherichia coli K-12 MG1655: b3244Help
Entry
b3244             CDS       T00007                                 

Gene name
tldD
Definition
(RefSeq) putative peptidase
  KO
K03568  
TldD protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Peptidases [BR:eco01002]
 Peptidases of Unknown Catalytic Type
  Family U62
   b3244 (tldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3390583..3392028)
Genome map
AA seq 481 aa AA seqDB search
MSLNLVSEQLLAANGLKHQDLFAILGQLAERRLDYGDLYFQSSYHESWVLEDRIIKDGSY
NIDQGVGVRAISGEKTGFAYADQISLLALEQSAQAARTIVRDSGDGKVQTLGAVEHSPLY
TSVDPLQSMSREEKLDILRRVDKVAREADKRVQEVTASLSGVYELILVAATDGTLAADVR
PLVRLSVSVLVEEDGKRERGASGGGGRFGYEFFLADLDGEVRADAWAKEAVRMALVNLSA
VAAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVFSGQVGELVASELCTVVDDG
TMVDRRGSVAIDDEGTPGQYNVLIENGILKGYMQDKLNARLMGMTPTGNGRRESYAHLPM
PRMTNTYMLPGKSTPQEIIESVEYGIYAPNFGGGQVDITSGKFVFSTSEAYLIENGKVTK
PVKGATLIGSGIETMQQISMVGNDLKLDNGVGVCGKEGQSLPVGVGQPTLKVDNLTVGGT
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttaacctggtaagtgaacaattgctagcggcgaacggcctgaaacatcaggac
ttgttcgcgatcctcggtcaactggccgaacgtcgccttgattatggcgatctctatttt
cagtcgagctatcacgaatcctgggttttagaagaccgcattattaaagatggttcttac
aacatcgatcagggcgttggtgtgcgtgcaatcagcggtgaaaaaaccggatttgcttac
gctgaccaaatcagcctgctggcgctggaacagagtgcgcaagcggcgcgcaccatcgtc
cgtgatagtggtgatggtaaagtacagacgctgggcgcggtagagcatagcccgttgtat
acctcggtagatccgctgcaaagcatgagccgtgaagagaagctggatatcctgcgtcgc
gtcgataaggttgcccgcgaagcggacaagcgcgtacaggaagtgactgccagcctcagt
ggtgtctatgaattaattttggttgcggccaccgacggcacgctagcggcggatgtccgt
ccgctggtgcgtctttccgtgagcgttctcgtcgaagaagatggcaaacgcgaacgcggt
gccagtggcggcggcggtcgttttggttatgaattcttccttgccgatctcgacggcgaa
gtccgtgcggatgcatgggcaaaagaagcagtgcgtatggcgctggtcaatctttctgcc
gttgctgcaccagcgggcaccatgccggtagtacttggcgcaggttggccgggcgtgctg
ttgcatgaagcggttggtcacggtctggaaggcgacttcaaccgccgtggcacttcagta
tttagtggacaggtcggggagctggtggcttcagaactgtgtaccgtggttgatgatggc
acgatggtcgatcgccgaggttcggtggcgattgatgacgaaggtacgccaggccagtac
aacgtgctgattgagaacggcattctgaaaggctacatgcaggataaactcaacgcgcgt
ttgatggggatgacgccgactggcaacggtcgccgtgaatcctacgcccatctgcccatg
ccgcgtatgaccaacacctatatgctgccgggtaaatcgaccccgcaggaaattattgaa
tccgttgagtacggtatctatgcaccgaactttggtggcggtcaggtggatatcacctcc
ggcaaattcgttttctccacttcagaagcatatctgattgaaaacggtaaagtaacgaag
ccggtgaaaggcgcaacgttgattggttccggtatcgaaaccatgcagcagatttcgatg
gttggcaacgacctgaaactggataacggcgtgggtgtctgcggtaaagaagggcaaagt
ttgccggttggcgtgggccagccaacgttgaaagtcgataacctgactgttggcggtact
gcgtaa

DBGET integrated database retrieval system