KEGG   Escherichia coli K-12 MG1655: b3311Help
Entry
b3311             CDS       T00007                                 

Gene name
rpsQ
Definition
(RefSeq) 30S ribosomal subunit protein S17
  KO
K02961  
small subunit ribosomal protein S17
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    b3311 (rpsQ)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    b3311 (rpsQ)
  Bacteria
    b3311 (rpsQ)
  Archaea
    b3311 (rpsQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3448314..3448568)
Genome map
AA seq 84 aa AA seqDB search
MTDKIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVE
IRECRPLSKTKSWTLVRVVEKAVL
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaatccgtactctgcaaggtcgcgttgttagcgacaaaatggagaaatcc
attgttgttgctatcgaacgttttgtgaaacacccgatctacggtaaattcatcaagcgt
acgaccaaactgcacgtacatgacgagaacaacgaatgcggtatcggtgacgtggttgaa
atccgcgaatgccgtccgctgtccaagactaaatcctggacgctggttcgcgttgtagag
aaagcggttctgtaa

DBGET integrated database retrieval system