KEGG   Escherichia coli K-12 MG1655: b3311Help
Entry
b3311             CDS       T00007                                 

Gene name
rpsQ
Definition
(RefSeq) 30S ribosomal subunit protein S17
  KO
K02961  small subunit ribosomal protein S17
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    b3311 (rpsQ)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    b3311 (rpsQ)
  Bacteria
    b3311 (rpsQ)
  Archaea
    b3311 (rpsQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S17
Motif
Other DBs
NCBI-GeneID: 947808
NCBI-ProteinID: NP_417770
Pasteur: rpsQ
RegulonDB: ECK120000907
ECOCYC: EG10916
ASAP: ABE-0010840
UniProt: P0AG63
Structure
PDB: 

Jmol
Position
complement(3448314..3448568)
Genome map
AA seq 84 aa AA seqDB search
MTDKIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVE
IRECRPLSKTKSWTLVRVVEKAVL
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaatccgtactctgcaaggtcgcgttgttagcgacaaaatggagaaatcc
attgttgttgctatcgaacgttttgtgaaacacccgatctacggtaaattcatcaagcgt
acgaccaaactgcacgtacatgacgagaacaacgaatgcggtatcggtgacgtggttgaa
atccgcgaatgccgtccgctgtccaagactaaatcctggacgctggttcgcgttgtagag
aaagcggttctgtaa

DBGET integrated database retrieval system