KEGG   Escherichia coli K-12 MG1655: b3321Help
Entry
b3321             CDS       T00007                                 

Gene name
rpsJ
Definition
(RefSeq) 30S ribosomal subunit protein S10
  KO
K02946  small subunit ribosomal protein S10
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    b3321 (rpsJ)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    b3321 (rpsJ)
  Bacteria
    b3321 (rpsJ)
  Archaea
    b3321 (rpsJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S10
Motif
Other DBs
NCBI-GeneID: 947816
NCBI-ProteinID: NP_417780
Pasteur: rpsJ
RegulonDB: ECK120000900
ECOCYC: EG10909
ASAP: ABE-0010862
UniProt: P0A7R5
Structure
PDB: 

Jmol
Position
complement(3452959..3453270)
Genome map
AA seq 103 aa AA seqDB search
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccaaagaatccgtatccgcctgaaagcgtttgatcatcgtctgatcgatcaa
gcaaccgcggaaatcgtcgagactgccaagcgcactggtgcgcaggtccgtggtccgatc
ccgctgccgacacgcaaagagcgcttcactgttctgatctccccgcacgtcaacaaagac
gcgcgcgatcagtacgaaatccgtactcacttgcgtctggttgacatcgttgagccaacc
gagaaaaccgttgatgctctgatgcgtctggatctggctgccggtgtagacgtgcagatc
agcctgggttaa

DBGET integrated database retrieval system