KEGG   Escherichia coli K-12 MG1655: b3323Help
Entry
b3323             CDS       T00007                                 

Gene name
gspA
Definition
(RefSeq) general secretory pathway component, cryptic
  KO
K02450  
general secretion pathway protein A
Organism
eco  Escherichia coli K-12 MG1655
Module
Type II general secretion pathway
Brite
Secretion system [BR:eco02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   b3323 (gspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3453929..3455398)
Genome map
AA seq 489 aa AA seqDB search
MSTRREVILSWLCEKRQTWRLCYLLGEAGSGKTWLAQQLQKDKHRRVITLSLVVSWQGKA
AWIVTDDNAAEQGCRDSAWTRDEMAGQLLHALHRTDSRCPLIIIENAHLNHRRILDDLQR
AISLIPDGQFLLIGRPDRKVERDFKKQGIELVSIGRLTEHELKASILEGQNIDQPDLLLT
ARVLKRIALLCRGDRRKLALAGETIRLLQQAEQTSVFTAKQWRMIYRILGDNRPRKMQLA
VVMSGTIIALTCGWLLLSSFTATLPVPAWLIPVTPVVKQDMTKDIAHVVMRDSEALSVLY
GVWGYEVPADSAWCDQAVRAGLACKSGNASLQTLVDQNLPWIASLKVGDKKLPVVVVRVG
EASVDVLVGQQTWTLTHKWFESVWTGDYLLLWKMSPEGESTITRDSSEEEILWLETMLNR
ALHISTEPSAEWRPLLVEKIKQFQKSHHLKTDGVVGFSTLVHLWQVAGESAYLYRDEANI
SPETTVKGK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgagaagagaagttattctttcctggttgtgtgagaaacgtcaaacctggcgt
ctatgctatttgttgggtgaggctggaagtggaaaaacctggctggcgcagcaactgcaa
aaagataaacatcgccgtgtgattactttaagcctcgttgtttcctggcaaggtaaggcc
gcatggatcgttaccgacgataacgcggctgaacagggctgccgtgacagcgcctggacg
cgagatgagatggcggggcaattactgcatgcgcttcatcgaactgatagtcgctgccct
cttattattattgaaaatgctcacctgaatcaccgccgcatacttgatgatctccaacgc
gcaatatctcttattcctgacggtcaatttttgctgatcggcagacccgatcgaaaagtc
gaacgtgattttaaaaaacagggcattgaacttgtctcgataggacgtctgacggagcac
gaacttaaggcaagcatccttgaaggtcagaatattgaccaacccgatctccttttaacc
gccagagttctgaaacggatagctttattatgtcggggcgatcgcagaaagctggcgctt
gccggcgaaacaattcgcttattacagcaagccgagcagaccagcgttttcacagcaaaa
caatggcgaatgatttaccgcatattgggtgataaccgcccccggaaaatgcagcttgcc
gtggtgatgagtggaaccattatcgctcttacctgtggttggctactgctgtcctctttt
acagctacgttacccgttcctgcgtggctgatacccgtaacgccagtagttaaacaagat
atgactaaggatattgctcatgtggtgatgcgcgatagtgaggcgctaagcgtgttatac
ggcgtatgggggtacgaggtcccagctgattcggcctggtgcgatcaggcagtaagagcg
gggctggcatgtaaaagtgggaatgcttctttacaaacattggtagatcagaatttgccc
tggatcgcatcgcttaaagtcggggacaaaaaattgcctgttgtggtcgttcgcgtcggt
gaggctagcgttgatgtcctcgtaggtcagcaaacgtggacgctgacacataaatggttt
gagtcggtatggacgggtgattatcttctgttgtggaaaatgtcgccggaaggggagagt
accattacgcgtgatagcagcgaggaagagattctctggctggaaacgatgttaaaccgc
gcattgcatatttcgacagaaccttcggcggagtggcgtcccttgttggtagaaaaaata
aagcaatttcaaaaaagccaccacttgaaaactgacggtgttgttggcttttcaacgtta
gtacatctctggcaggtggcaggggagagtgcctacttatatcgggatgaagcaaatatt
tccccggaaacaacagtgaaggggaaatga

DBGET integrated database retrieval system