KEGG   Escherichia coli K-12 MG1655: b3341Help
Entry
b3341             CDS       T00007                                 

Gene name
rpsG
Definition
(RefSeq) 30S ribosomal subunit protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    b3341 (rpsG)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    b3341 (rpsG)
  Bacteria
    b3341 (rpsG)
  Archaea
    b3341 (rpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7 ArgJ
Motif
Other DBs
NCBI-GeneID: 947846
NCBI-ProteinID: NP_417800
Pasteur: rpsG
RegulonDB: ECK120000897
ECOCYC: EG10906
ASAP: ABE-0010917
UniProt: P02359
Structure
PDB: 

Jmol
Position
complement(3473542..3474081)
Genome map
AA seq 179 aa AA seqDB search
MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELE
AFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRL
ANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRWLSLRSFSHQAGASSKQPALGYLN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtcgtcgcgtcattggtcagcgtaaaattctgccggatccgaagttcggatca
gaactgctggctaaatttgtaaatatcctgatggtagatggtaaaaaatctactgctgaa
tctatcgtatacagcgcgctggagaccctggctcagcgctctggtaaatctgaactggaa
gcattcgaagtagctctcgaaaacgtgcgcccgactgtagaagttaagtctcgccgcgtt
ggtggttctacttatcaggtaccagttgaagtccgtccggttcgtcgtaatgctctggca
atgcgttggatcgttgaagctgctcgtaaacgcggtgataaatccatggctctgcgcctg
gcgaacgaactttctgatgctgcagaaaacaaaggtactgcagttaagaaacgtgaagac
gttcaccgtatggccgaagccaacaaggcgttcgcacactaccgttggttatcccttcgg
agttttagtcaccaggcgggcgcttccagtaagcagcccgctttgggctacttaaattga

DBGET integrated database retrieval system