KEGG   Escherichia coli K-12 MG1655: b3344Help
Entry
b3344             CDS       T00007                                 

Gene name
tusC
Definition
(RefSeq) mnm(5)-s(2)U34-tRNA synthesis 2-thiolation protein
  KO
K07236  tRNA 2-thiouridine synthesizing protein C
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    b3344 (tusC)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    b3344 (tusC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DrsE Ribosomal_L5
Motif
Other DBs
NCBI-GeneID: 947853
NCBI-ProteinID: NP_417803
Pasteur: yheM
RegulonDB: ECK120004258
ECOCYC: G7713
ASAP: ABE-0010928
UniProt: P45531
Structure
PDB: 

Jmol
Position
complement(3474973..3475332)
Genome map
AA seq 119 aa AA seqDB search
MKRIAFVFSTAPHGTAAGREGLDALLATSALTDDLAVFFIADGVFQLLPGQKPDAVLARD
YIATFKLLGLYDIEQCWVCAASLRERGLDPQTPFVVEATPLEADALRRELANYDVILRF
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcgtttgttttttctactgcacctcatggtacagccgcaggccgggaa
ggtttagatgctttactggcaacttccgcattaactgacgatctggctgtcttctttata
gctgatggcgtttttcagctgctgccaggacaaaagcccgatgcagtgctggcgcgtgat
tacattgccacttttaaattgttgggtctgtacgacattgaacagtgctgggtttgtgcg
gcttcactgcgcgaacgcgggttagatccgcagacaccctttgttgtcgaagccacgccg
ctcgaagcagatgccttacgccgcgaactcgccaactacgatgttattttgaggttttga

DBGET integrated database retrieval system