KEGG   Escherichia coli K-12 MG1655: b3350Help
Entry
b3350             CDS       T00007                                 

Gene name
kefB
Definition
(RefSeq) potassium:proton antiporter
  KO
K11747  
glutathione-regulated potassium-efflux system protein KefB
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3350 (kefB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3478802..3480607)
Genome map
AA seq 601 aa AA seqDB search
MEGSDFLLAGVLFLFAAVAAVPLASRLGIGAVLGYLLAGIAIGPWGLGFISDVDEILHFS
ELGVVFLMFIIGLELNPSKLWQLRRSIFGVGAAQVLLSAALLAGLLMLTDFAWQAAVVGG
IGLAMSSTAMALQLMREKGMNRSESGQLGFSVLLFQDLAVIPALALVPLLAGSADEHFDW
MKVGMKVLAFVGMLIGGRYLLRPVFRFIAASGVREVFTAATLLLVLGSALFMDALGLSMA
LGTFIAGVLLAESEYRHELETAIDPFKGLLLGLFFISVGMSLNLGVLYTHLLWVVISVVV
LVAVKILVLYLLARLYGVRSSERMQFAGVLSQGGEFAFVLFSTASSQRLFQGDQMALLLV
TVTLSMMTTPLLMKLVDKWLSRQFNGPEEEDEKPWVNDDKPQVIVVGFGRFGQVIGRLLM
ANKMRITVLERDISAVNLMRKYGYKVYYGDATQVDLLRSAGAEAAESIVITCNEPEDTMK
LVEICQQHFPHLHILARARGRVEAHELLQAGVTQFSRETFSSALELGRKTLVTLGMHPHQ
AQRAQLHFRRLDMRMLRELIPMHADTVQISRAREARRELEEIFQREMQQERRQLDGWDEF
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggaaggttccgattttttactcgcaggagtgctgtttctcttcgcggcggtggctgcg
gtgccgctggcatcgcggctgggtattggcgctgtgttgggatatttgctggcagggatt
gcaattggcccgtgggggctggggtttattagcgacgtcgatgagatcctccacttttcg
gaactcggcgtggtattcctgatgtttatcatcggccttgagttgaatccctccaaactt
tggcaactgcggcgttcgatttttggcgtaggcgcggcacaggtgctgttaagcgcggcg
ttgctggcgggattattgatgctgacggatttcgcctggcaggcggcggtggtcggtggc
attggccttgcgatgtcttcaactgcaatggcgttgcaattgatgcgtgagaaagggatg
aatcgcagcgaatccggccagctcgggttttcggttctgctgtttcaggatctggcagta
atcccagcactggcgttagtgccgttgttggcggggtcggcagacgaacatttcgactgg
atgaaggtcggcatgaaggtgctggcgtttgtcggcatgctgattggtgggcgctattta
ctgcgtccggtattccgctttattgcagcttctggcgtgcgggaagtgttcaccgccgcg
acgctgctgctggtgttgggttccgcattgtttatggatgcgctggggctgtcgatggcg
ctcggtacatttattgcgggcgtgctgctggcggaaagtgaatatcgccatgaactggaa
acggctatcgatcccttcaaaggcttgctgctcggtttgttctttatctctgtcggcatg
tcactcaacctcggggtgctttatacccatctgttgtgggtagtgataagcgtggttgtg
ctggtggcggtgaaaattctcgtgctgtatctgctggcgcgattgtatggcgtgcgtagc
tcagagcggatgcagtttgctggcgtgttgagtcagggtggtgagtttgcctttgtcctc
ttttctaccgcttcttcacaacgcttattccagggcgaccagatggcgttgttgctggtg
acggtgacgctttccatgatgaccacgccgttgctgatgaagctggtggataaatggcta
tcccgccagtttaacggaccggaagaagaagacgaaaaaccgtgggtcaacgatgataaa
ccccaggtcattgtcgtgggcttcgggcgttttggtcaggtgattggtcgtttgctgatg
gcaaataaaatgcgcattaccgtgctggagcgggatatcagcgccgttaacctgatgcgt
aaatacggctacaaagtttattacggcgacgccacgcaggtcgatcttttacgttctgcg
ggtgcagaggccgctgagtctatcgtcattacctgtaacgagccggaagacaccatgaag
ctggtggaaatatgccaacagcactttccgcatttgcatattcttgcgcgagcgcgcgga
cgtgtggaagcgcatgagttattacaggcaggggtgacgcagttttcccgtgaaacattc
tccagtgcgttagagctggggcgcaagacgctggtcacgcttggcatgcatccgcatcag
gcacagcgagcgcaactgcattttcgccgcctggatatgcggatgctgcgagagctcatc
ccaatgcatgccgataccgtacaaatttctcgcgccagggaagcccgacgcgaactggaa
gagattttccagcgtgaaatgcaacaagaacgacgccagctggacggctgggatgaattt
gagtag

DBGET integrated database retrieval system