KEGG   Escherichia coli K-12 MG1655: b3351Help
Entry
b3351             CDS       T00007                                 

Gene name
kefG
Definition
(RefSeq) potassium-efflux system ancillary protein for KefB, glutathione-regulated
  KO
K11748  
glutathione-regulated potassium-efflux system ancillary protein KefG
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3351 (kefG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3480607..3481161)
Genome map
AA seq 184 aa AA seqDB search
MMSQPAKVLLLYAHPESQDSVANRVLLKPATQLSNVTVHDLYAHYPDFFIDIPREQALLR
EHEVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLAGKYWRSVITTGEPESAYR
YDALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAQELASHARAYGDWLANPLS
PGGR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctcagccagcgaaagttttgctgctgtatgcccatccggaatctcaggactcg
gtggcaaaccgggtactgcttaaaccggccacgcagctcagcaatgttaccgtgcacgac
ctttacgcgcactatcccgatttttttattgatatcccccgtgagcaggcattactgcgc
gagcacgaggtgattgtctttcagcatcctctttatacctatagctgcccggcgctactg
aaagagtggctggaccgggtattaagtcgtggttttgccagcgggccgggaggaaaccaa
ctggcgggaaagtactggcgtagcgtgattaccaccggcgagccggaaagtgcttaccgt
tatgacgcgctgaatcgctacccgatgagcgatgtgctgcgcccctttgaactggcggcg
ggcatgtgccggatgcattggttaagtcccatcattatttactgggcgagacggcaaagc
gcacaggagctggcgagccacgccagagcctacggtgactggctggcaaatccgctgtct
ccaggaggccgctga

DBGET integrated database retrieval system