KEGG   Escherichia coli K-12 MG1655: b3360Help
Entry
b3360             CDS       T00007                                 

Gene name
pabA
Definition
(RefSeq) aminodeoxychorismate synthase, subunit II
  KO
K01664  
para-aminobenzoate synthetase component II [EC:2.6.1.85]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    b3360 (pabA)
Enzymes [BR:eco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     b3360 (pabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3490266..3490829)
Genome map
AA seq 187 aa AA seqDB search
MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAG
ISLDVIRHYAGRLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLAN
PLTVTRYHSLVVEPDSLPACFDVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQL
LANFLHR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcttatagataactacgattcttttacctggaacctctaccagtacttttgt
gaactgggggcggatgtgctggttaagcgcaacgatgcgttgacgctggcggatatcgac
gcccttaaaccacaaaaaattgtcatctcacctggcccctgtacgccagatgaagccggg
atctcccttgacgttattcgccactatgccgggcgcttgccgattcttggcgtctgcctc
ggtcatcaggcaatggcgcaggcatttggcggtaaagttgtgcgcgccgcaaaggtcatg
cacggcaaaacctcgccgattacacataacggtgagggcgtatttcgggggctggcaaat
ccacttaccgtgacacgctaccattcgctggtggtggaacctgactcattaccagcgtgc
tttgacgtgacggcctggagcgaaacccgagagattatggggattcgccatcgccagtgg
gatctggaaggtgtgcagttccatccagaaagtattcttagcgaacaaggacatcaactg
ctggctaatttcctgcatcgctga

DBGET integrated database retrieval system