KEGG   Escherichia coli K-12 MG1655: b3367Help
Entry
b3367             CDS       T00007                                 

Gene name
nirC
Definition
(RefSeq) nitrite transporter
  KO
K02598  
nitrite transporter NirC
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3367 (nirC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3497003..3497809
Genome map
AA seq 268 aa AA seqDB search
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVA
MLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKF
IAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPKANRPVADKFNQTETAAG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacactattaataagtgtgcggctaacgctgcgcgcattgcacgcctgtcg
gcaaataacccgctcggcttttgggtcagctccgccatggcgggcgcgtatgtgggtctt
gggatcatcctgattttcacgctcggtaatttgctcgatccatccgtacgccctttggtg
atgggcgcgacctttggtatcgccttaacgctggtgattatcgccggttctgaactgttc
accggacacaccatgttcctcacctttggggtaaaagcgggcagcatcagccacgggcaa
atgtgggcaatcctgccgcaaacctggctgggtaacctggtcggttccgtcttcgttgcc
atgctctatagctggggcggcggtagcctgctgccggtagataccagcatcgttcactcc
gtcgcgctggctaaaaccactgcaccggcaatggtactcttcttcaaaggtgcattgtgt
aactggctggtttgcctggcaatctggatggcgctgcgcactgaaggggcggcgaaattt
atcgctatctggtggtgtctgctggcatttatcgcgtccggctacgagcactctatcgct
aacatgacgctgttcgcgctctcctggttcggcaaccacagcgaagcctacacgctggcg
ggtattggtcataacctgctgtgggtgacgctgggtaatactttatcaggtgccgtattc
atgggattgggttattggtatgctacgccgaaagcgaatcgtccggttgcggacaaattt
aatcaaactgaaacggctgccggttaa

DBGET integrated database retrieval system