KEGG   Escherichia coli K-12 MG1655: b3367Help
Entry
b3367             CDS       T00007                                 

Gene name
nirC
Definition
(RefSeq) nitrite transporter
  KO
K02598  nitrite transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b3367 (nirC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans Phage_holin_2_4
Motif
Other DBs
NCBI-GeneID: 2847757
NCBI-ProteinID: YP_026212
Pasteur: nirC
RegulonDB: ECK120000647
ECOCYC: EG10654
ASAP: ABE-0011008
UniProt: P0AC26
Position
3497003..3497809
Genome map
AA seq 268 aa AA seqDB search
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVA
MLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKF
IAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPKANRPVADKFNQTETAAG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacactattaataagtgtgcggctaacgctgcgcgcattgcacgcctgtcg
gcaaataacccgctcggcttttgggtcagctccgccatggcgggcgcgtatgtgggtctt
gggatcatcctgattttcacgctcggtaatttgctcgatccatccgtacgccctttggtg
atgggcgcgacctttggtatcgccttaacgctggtgattatcgccggttctgaactgttc
accggacacaccatgttcctcacctttggggtaaaagcgggcagcatcagccacgggcaa
atgtgggcaatcctgccgcaaacctggctgggtaacctggtcggttccgtcttcgttgcc
atgctctatagctggggcggcggtagcctgctgccggtagataccagcatcgttcactcc
gtcgcgctggctaaaaccactgcaccggcaatggtactcttcttcaaaggtgcattgtgt
aactggctggtttgcctggcaatctggatggcgctgcgcactgaaggggcggcgaaattt
atcgctatctggtggtgtctgctggcatttatcgcgtccggctacgagcactctatcgct
aacatgacgctgttcgcgctctcctggttcggcaaccacagcgaagcctacacgctggcg
ggtattggtcataacctgctgtgggtgacgctgggtaatactttatcaggtgccgtattc
atgggattgggttattggtatgctacgccgaaagcgaatcgtccggttgcggacaaattt
aatcaaactgaaacggctgccggttaa

DBGET integrated database retrieval system