KEGG   Escherichia coli K-12 MG1655: b3411Help
Entry
b3411             CDS       T00007                                 

Gene name
yhgA
Definition
(RefSeq) transposase_31 family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3543167..3544045
Genome map
AA seq 292 aa AA seqDB search
MSKKQSSTPHDALFKLFLRQPDTARDFLAFHLPAPIHALCDMKTLKLESSSFIDDDLRES
YSDVLWSVKTEQGPGYIYCLIEHQSTSNKLIAFRMMRYAIAAMQNHLDAGYKTLPMVVPL
LFYHGIESPYPYSLCWLDCFADPKLARQLYASAFPLIDVTVMPDDEIMQHRRMALLELIQ
KHIRQRDLMGLVEQMACLLSSGYANDRQIKGLFNYILQTGDAVRFNDFIDGVAERSPKHK
ESLMTIAERLRQEGEQSKALHIAKIMLESGVPLADIMRFTGLSEEELAAASQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaagcagagttccaccccacacgatgcgctgttcaaactctttttacgccaa
ccggacacggctcgtgattttcttgcgtttcatttaccggcacccattcacgcgctttgt
gatatgaaaaccctcaagctggagtcgagcagctttattgatgacgatctgcgtgaaagc
tattccgatgtgctgtggtcggtgaaaacggaacaaggaccaggatacatctattgtctg
attgaacatcaaagcacctcaaacaaactgatcgcatttcgcatgatgcgttacgctatt
gccgcaatgcaaaatcaccttgatgctggatacaaaacgttgccgatggtggtgccattg
ttgttttaccacggtattgaaagcccctatccctattcgctgtgttggctggattgtttc
gccgatcccaaactggcaaggcagctttatgcctccgcatttccgctgattgatgtcacc
gtcatgcctgatgatgaaatcatgcagcaccgacgtatggcgctgctggagttaattcaa
aaacatattcgtcaacgcgacctgatggggctggtagagcaaatggcctgcttattaagt
agtggatacgctaatgacagacaaatcaaagggctgtttaattacatactgcaaactggc
gacgctgtacgttttaacgattttatcgacggcgttgccgaacgttcaccgaaacacaag
gagagtttaatgactattgcggaaagattgcggcaggagggggaacaatccaaagccctg
catatagccaaaataatgcttgaatccggagttcctcttgcagacatcatgcgctttacc
gggctgtcagaagaagagttggctgcggcgagtcagtaa

DBGET integrated database retrieval system