KEGG   Escherichia coli K-12 MG1655: b3414Help
Entry
b3414             CDS       T00007                                 

Gene name
nfuA
Definition
(RefSeq) Fe/S biogenesis protein; putative scaffold/chaperone for damaged Fe/S proteins
  KO
K07400  
Fe/S biogenesis protein NfuA
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3545624..3546199
Genome map
AA seq 191 aa AA seqDB search
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDL
LTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQIN
PQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDL
TEHQRGEHSYY
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtatttccgatgctgcacaagcgcactttgccaaactgctggcaaatcaggaa
gaagggacacaaatccgcgtatttgtgattaaccctggcacgcctaacgctgaatgtggc
gtttcttattgtccgccggacgctgtggaagccaccgacacagccctgaaatttgacctg
ctgaccgcgtatgttgatgagttaagcgcaccatacctggaagatgcagagatcgatttt
gttaccgaccagttgggttcccagttaacgctgaaagccccgaacgccaaaatgcgtaaa
gtggcagacgatgcaccgctgatggagcgcgtggagtatatgctgcagtcgcagatcaac
ccacagcttgctggtcacggtggtcgcgtttcgctgatggaaatcaccgaagacggttac
gccattctgcaatttggcggcggctgtaacggttgttccatggtcgatgtgacgctgaaa
gaagggatcgagaagcagctgctgaacgaattcccggagctgaaaggtgtgcgcgatctc
accgaacaccagcgcggcgaacactcctactactaa

DBGET integrated database retrieval system