KEGG   Escherichia coli K-12 MG1655: b3415Help
Entry
b3415             CDS       T00007                                 

Gene name
gntT
Definition
(RefSeq) gluconate transporter, high-affinity GNT I system
  KO
K06155  
Gnt-I system high-affinity gluconate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3415 (gntT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3546559..3547875
Genome map
AA seq 438 aa AA seqDB search
MPLVIVAIGVILLLLLMIRFKMNGFIALVLVALAVGLMQGMPLDKVIGSIKAGVGGTLGS
LALIMGFGAMLGKMLADCGGAQRIATTLIAKFGKKHIQWAVVLTGFTVGFALFYEVGFVL
MLPLVFTIAASANIPLLYVGVPMAAALSVTHGFLPPHPGPTAIATIFNADMGKTLLYGTI
LAIPTVILAGPVYARVLKGIDKPIPEGLYSAKTFSEEEMPSFGVSVWTSLVPVVLMAMRA
IAEMILPKGHAFLPVAEFLGDPVMATLIAVLIAMFTFGLNRGRSMDQINDTLVSSIKIIA
MMLLIIGGGGAFKQVLVDSGVDKYIASMMHETNISPLLMAWSIAAVLRIALGSATVAAIT
AGGIAAPLIATTGVSPELMVIAVGSGSVIFSHVNDPGFWLFKEYFNLTIGETIKSWSMLE
TIISVCGLVGCLLLNMVI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccattagtcattgttgctatcggtgtaatcttgttgttgctcctgatgatccgcttc
aaaatgaacggcttcatcgctctcgtcctcgtggcgcttgctgttggattaatgcaagga
atgccgctggataaagttattggctccatcaaagccggtgtcggcgggacgctcggtagc
cttgccctgatcatgggttttggcgcaatgctgggcaaaatgctggcagactgcggtggc
gcacaacgtatcgccaccacgctgattgccaaatttggtaaaaaacacatccagtgggcg
gtggtactgaccggttttaccgttggttttgccctgttctatgaagtgggctttgtgctg
atgctgccgctggtgtttaccatcgcggcttctgcgaatattccactgctgtatgttggt
gtaccaatggcggctgcactgtctgtgacccacggcttcctgccaccgcatccgggtccg
actgcgattgccaccattttcaatgccgatatgggtaaaaccctgctgtacggtactatt
ctggcaatcccgaccgtgattctcgccggtccggtttacgctcgcgtgttgaaaggtatc
gataagccaattccggaaggtctctacagcgcgaaaaccttcagcgaagaagagatgccg
agctttggcgtcagcgtctggacctctctggtgccggtagtactgatggcgatgcgtgcg
attgccgaaatgatcctgccgaaaggtcacgctttcctgccggtagcggagttcctcggt
gacccggtaatggcaacgctgattgccgtgctgattgcgatgttcacctttggtctaaac
cgtggtcgttcaatggatcagattaacgacacgctggtttcttccatcaaaatcattgcg
atgatgctgttgatcatcggtggtggcggtgcgttcaagcaggtgctggtagacagcggc
gtggacaaatacattgcttccatgatgcacgaaaccaacatttctccgctgctgatggcc
tggtcgattgctgccgtactgcgtatcgcgctgggttccgcaaccgttgcggcaatcact
gcgggtggtatcgcggcaccgctgattgcaacgacgggtgttagcccggagctgatggtt
attgcggttggttccggtagtgtgattttctctcatgtgaacgatccgggcttctggctg
ttcaaagagtactttaacctgactatcggcgagaccatcaaatcctggtcgatgctggaa
accattatctcggtgtgcggtctggtaggctgtctgctgctgaatatggtgatttga

DBGET integrated database retrieval system