KEGG   Escherichia coli K-12 MG1655: b3424Help
Entry
b3424             CDS       T00007                                 

Gene name
glpG
Definition
(RefSeq) rhomboid intramembrane serine protease
  KO
K02441  GlpG protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhomboid_N Rhomboid
Motif
Other DBs
NCBI-GeneID: 947936
NCBI-ProteinID: YP_026220
Pasteur: glpG
RegulonDB: ECK120000390
ECOCYC: EG10397
ASAP: ABE-0011179
UniProt: P09391
Structure
PDB: 

Jmol
Position
complement(3560622..3561452)
Genome map
AA seq 276 aa AA seqDB search
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA
DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM
LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI
SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG
WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgattacctcttttgctaacccccgcgtggcgcaggcgtttgttgattacatg
gcgacgcagggtgttatcctcacgattcaacaacataaccaaagcgatgtctggctggcg
gatgagtcccaggccgagcgcgtacgggcggagctggcgcgttttctcgaaaacccggca
gatccgcgttatctggcggcgagctggcaggcaggccataccggcagtggcctgcattat
cgccgttatcctttctttgccgccttgcgtgaacgcgcaggtccggtaacctgggtgatg
atgatcgcctgcgtggtggtgtttattgccatgcaaattctcggcgatcaggaagtgatg
ttatggctggcctggccattcgatccaacactgaaatttgagttctggcgttacttcacc
cacgcgttaatgcacttctcgctgatgcatatcctctttaacctgctctggtggtggtat
ctcggcggtgcggtggaaaaacgcctcggtagcggtaagctaattgtcattacgcttatc
agcgccctgttaagcggctatgtgcagcaaaaattcagcgggccgtggtttggcgggctt
tctggcgtggtgtatgcgctgatgggctacgtctggctacgtggcgaacgcgatccgcaa
agtggcatttacctgcaacgtgggttaattatctttgcgctgatctggattgtcgccgga
tggtttgatttgtttgggatgtcgatggcgaacggagcacacatcgccgggttagccgtg
ggtttagcgatggcttttgttgattcgctcaatgcgcgaaaacgaaaataa

DBGET integrated database retrieval system