KEGG   Escherichia coli K-12 MG1655: b3440Help
Entry
b3440             CDS       T00007                                 

Gene name
yhhX
Definition
(RefSeq) putative oxidoreductase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3579768..3580805)
Genome map
AA seq 345 aa AA seqDB search
MVINCAFIGFGKSTTRYHLPYVLNRKDSWHVAHIFRRHAKPEEQAPIYSHIHFTSDLDEV
LNDPDVKLVVVCTHADSHFEYAKRALEAGKNVLVEKPFTPTLAQAKELFALAKSKGLTVT
PYQNRRFDSCFLTAKKAIESGKLGEIVEVESHFDYYRPVAETKPGLPQDGAFYGLGVHTM
DQIISLFGRPDHVAYDIRSLRNKANPDDTFEAQLFYGDLKAIVKTSHLVKIDYPKFIVHG
KKGSFIKYGIDQQETSLKANIMPGEPGFAADDSVGVLEYVNDEGVTVREEMKPEMGDYGR
VYDALYQTITHGAPNYVKESEVLTNLEILERGFEQASPSTVTLAK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcaactgcgcctttattggcttcggcaaaagcaccacccgttaccatctgccg
tatgtacttaaccgcaaggatagctggcatgtcgcgcatatttttcgtcgccatgcgaag
ccggaagaacaggctcccatttattcccatatccatttcaccagcgatctcgacgaagta
ctaaacgatcccgatgttaagctggttgttgtctgcacccacgcggacagccatttcgag
tacgcgaaacgcgcgctggaagccgggaaaaatgtgctggtcgaaaaaccgttcactccg
acacttgcgcaggcgaaagagctgtttgcgttggcgaaaagcaaagggctgaccgtcacg
ccgtatcagaatcgtcgctttgactcctgcttcctgacagcgaaaaaagcgattgaaagt
ggcaagttgggagagattgttgaagtggaaagccattttgactattaccgcccggtggca
gaaaccaaacctgggctgccgcaggatggcgcgttttatggccttggtgtgcatacgatg
gaccagattatttctctgttcggtcgcccggatcacgtcgcttatgacatccgcagcctg
cgtaataaagccaatcctgacgacacctttgaagcgcaactgttttatggcgacctgaaa
gccatcgtcaaaaccagccatctggtgaaaatcgattatccgaaatttatcgttcacggt
aagaaaggttcgtttattaaatacggtatcgaccagcaggaaaccagcctgaaggctaat
attatgccgggcgaaccgggattcgcagcggatgattcggtcggtgtgctggagtatgtc
aatgacgagggcgtgacggtcagagaagagatgaagccggagatgggcgattacgggcgc
gtttatgatgcgttgtatcaaaccatcacccacggtgcgccaaattacgtcaaggaatct
gaagttcttaccaatctggaaatccttgaacgcggatttgagcaagcctctccctccaca
gtaactctcgctaagtaa

DBGET integrated database retrieval system