KEGG   Escherichia coli K-12 MG1655: b3441Help
Entry
b3441             CDS       T00007                                 

Gene name
yhhY
Definition
(RefSeq) putative acetyltransferase
  KO
K03825  
putative acetyltransferase [EC:2.3.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     b3441 (yhhY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3581138..3581626
Genome map
AA seq 162 aa AA seqDB search
MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDG
DVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTV
FVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagatagtaatacgccacgcagaaacacgggattacgaggccatcaggcagatt
cacgcccagccggaggtgtattgcaacacactacaggtgcctcatccttccgatcatatg
tggcaggagcgactcgccgatcgtcccggcatcaagcaactcgtcgcctgtattgatgga
gacgtcgtgggccatctcaccattgacgtgcaacagcgcccacgccgcagtcatgttgcc
gattttggtatctgtgtcgactctcgttggaagaaccgcggcgtcgccagcgccctgatg
cgagagatgattgaaatgtgcgacaactggttgcgggtagatcgcattgaactaaccgtg
tttgtcgataacgccccggcaattaaggtctataaaaaatacggctttgaaattgaaggg
actggtaagaagtacgcattgcgtaatggtgaatatgtcgatgcatattatatggcgcgg
gtgaagtaa

DBGET integrated database retrieval system