KEGG   Escherichia coli K-12 MG1655: b3444Help
Entry
b3444             CDS       T00007                                 

Gene name
insA
Definition
(RefSeq) IS1 repressor TnpA
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_IS1 Zn_Tnp_IS1 FdhE zinc_ribbon_4 zinc_ribbon_10 HTH_23 HTH_28 Zn_Tnp_IS1595 Elf1 zf-Dof
Motif
Other DBs
NCBI-GeneID: 947950
NCBI-ProteinID: NP_417901
RegulonDB: ECK120004301
ASAP: ABE-0011249
UniProt: P0CF07 P0CF11 P0CF12
Position
3583483..3583758
Genome map
AA seq 91 aa AA seqDB search
MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA
MNGVGCRATARIMGVGLNTILRHLKNSGRSR
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
gtggcttctgtttctatcagctgtccctcctgttcagctactgacggggtggtgcgtaac
ggcaaaagcaccgccggacatcagcgctatctctgctctcactgccgtaaaacatggcaa
ctgcagttcacttacaccgcttctcaacccggtacgcaccagaaaatcattgatatggcc
atgaatggcgttggatgccgggcaacagcccgcattatgggcgttggcctcaacacgatt
ttacgtcacttaaaaaactcaggccgcagtcggtaa

DBGET integrated database retrieval system