KEGG   Escherichia coli K-12 MG1655: b3444Help
Entry
b3444             CDS       T00007                                 

Gene name
insA
Definition
(RefSeq) IS1 repressor TnpA
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ASAP: 
UniProt: 
Position
3583483..3583758
Genome map
AA seq 91 aa AA seqDB search
MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA
MNGVGCRATARIMGVGLNTILRHLKNSGRSR
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
gtggcttctgtttctatcagctgtccctcctgttcagctactgacggggtggtgcgtaac
ggcaaaagcaccgccggacatcagcgctatctctgctctcactgccgtaaaacatggcaa
ctgcagttcacttacaccgcttctcaacccggtacgcaccagaaaatcattgatatggcc
atgaatggcgttggatgccgggcaacagcccgcattatgggcgttggcctcaacacgatt
ttacgtcacttaaaaaactcaggccgcagtcggtaa

DBGET integrated database retrieval system