KEGG   Escherichia coli K-12 MG1655: b3445Help
Entry
b3445             CDS       T00007                                 

Gene name
insB1
Definition
(RefSeq) IS1 transposase B
  KO
K07480  
insertion element IS1 protein InsB
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ASAP: 
UniProt: 
Position
3583677..3584180
Genome map
AA seq 167 aa AA seqDB search
MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLF
YAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKR
YTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcaacagcccgcattatgggcgttggcctcaacacgattttacgtcacttaaa
aaactcaggccgcagtcggtaacctcgcgcatacagccgggcagtgacgtcatcgtctgc
gcggaaatggacgaacagtggggctatgtcggggctaaatcgcgccagcgctggctgttt
tacgcgtatgacagtctccggaagacggttgttgcgcacgtattcggtgaacgcactatg
gcgacgctggggcgtcttatgagcctgctgtcaccctttgacgtggtgatatggatgacg
gatggctggccgctgtatgaatcccgcctgaagggaaagctgcacgtaatcagcaagcga
tatacgcagcgaattgagcggcataacctgaatctgaggcagcacctggcacggctggga
cggaagtcgctgtcgttctcaaaatcggtggagctgcatgacaaagtcatcgggcattat
ctgaacataaaacactatcaataa

DBGET integrated database retrieval system