KEGG   Escherichia coli K-12 MG1655: b3451Help
Entry
b3451             CDS       T00007                                 

Gene name
ugpE
Definition
(RefSeq) glycerol-3-phosphate transporter subunit
  KO
K05815  
sn-glycerol 3-phosphate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3451 (ugpE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    b3451 (ugpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3589182..3590027)
Genome map
AA seq 281 aa AA seqDB search
MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHN
IWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT
LMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID
GASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT
GEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaaccgtccgtggctgacgatattcagccataccatgctgatcctcgggatc
gcggtgatcctcttcccgctgtacgtggcgtttgtcgcggcgacgctggataaacaggcc
gtctatgccgcgccgatgacgctcatccccggcacacatctgctggaaaacatccacaac
atctgggtgaacggggtaggcacgaatagcgcgccgttctggcggatgttgcttaacagc
tttgtgatggcgttcagcattacgctcggcaaaattaccgtctcgatgctctcggcattt
gccattgtctggtttcgttttccgctacgtaacctcttcttctggatgatttttatcacc
ctgatgctgccggttgaagtacgtatcttcccgacggtggaagtcatcgccaacctgcag
atgctcgacagctacgccggtttaacgctgccgctgatggcctcggcgaccgctactttc
ctgttccgccagttctttatgacgctgccggatgagctggtggaagccgcgcggatcgac
ggcgcatcgccaatgcgcttcttttgcgacatcgtttttccgctctccaaaactaatctg
gcggcgctgtttgtgatcacctttatctacggctggaatcagtatttgtggccgttgttg
attattaccgatgtggatctcggcaccaccgtggcagggatcaaagggatgatcgctaca
ggcgaaggcaccacggaatggaactcagtgatggtggcgatgttgttaacgcttatccct
ccggtggtgattgttttagtgatgcagcgtgccttcgtgcgcggcctggtcgatagtgag
aaataa

DBGET integrated database retrieval system