KEGG   Escherichia coli K-12 MG1655: b3452Help
Entry
b3452             CDS       T00007                                 

Gene name
ugpA
Definition
(RefSeq) sn-glycerol-3-phosphate ABC transporter permease
  KO
K05814  sn-glycerol 3-phosphate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3452 (ugpA)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    b3452 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 947957
NCBI-ProteinID: NP_417909
Pasteur: ugpA
RegulonDB: ECK120001035
ECOCYC: EG11046
ASAP: ABE-0011272
UniProt: P10905
Position
complement(3590024..3590911)
Genome map
AA seq 295 aa AA seqDB search
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV
TLFHDSYYLDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA
VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA
LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG
GPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatcccgtccggtgttccgctcgcgctggctgccttatctgctggtcgcgccg
cagctcatcatcaccgttatcttttttatctggcctgcgggcgaagcgttgtggtactcg
ctacaaagcgtcgatccgtttggtttctccagccagtttgtcggcctggataacttcgtc
acgctgttccatgacagctactatctcgactccttctggacgacgataaaattcagcacc
tttgtcaccgtcagcggtttgctggtatcgctgttctttgcggcgctggtggagtacatc
gtgcgcggcagccgtttctatcaaaccttaatgttgctgccttacgccgtggctcccgcc
gttgccgccgtattgtggatcttcctgtttaaccccggtcgcgggctgatcacccatttt
ctcgcggagttcggctacgactggaaccacgcgcaaaacagcggtcaggcaatgtttctg
gtggtgtttgcctcagtatggaagcaaatcagctacaacttcctgttcttctatgccgcg
ctgcaatccattccccgttcgttgatcgaagccgcagccatcgacggtgcagggccgatt
cgccgcttctttaagattgcgctgccgcttatcgccccggtgagtttcttcctgctggta
gtgaacctggtgtatgccttcttcgacaccttcccggtgatcgacgccgccacgtccggc
gggccggttcaggccaccacgacgctgatttataagatctaccgcgaaggttttaccgga
ctggatctggcttcgtctgccgcacagtcggtggtgttgatgttcctcgtcatcgtgctg
acggtggtgcagttccgctatgttgaaagcaaggtgcgttaccaatga

DBGET integrated database retrieval system